What are the different types of mountain bike knee and shin guards. How do you choose the right size and material for your riding style. What features should you look for when selecting knee and shin protection.
Types of Mountain Bike Knee and Shin Protection
Mountain biking enthusiasts have two main options when it comes to lower leg protection: knee pads and knee/shin pads. Each type offers distinct advantages depending on your riding style and preferences.
Knee Pads
Knee-only pads are designed to provide focused protection for the knee joint. They excel in:
- Offering superior protection against high-impact collisions
- Allowing greater freedom of movement
- Staying securely in place during rides
Riders who prioritize maneuverability and protection against significant impacts may find knee pads to be the ideal choice.
Knee/Shin Pads
Knee/shin pads offer more comprehensive protection, covering both the knee and shin areas. These pads typically feature:
- Hard plastic shells for impact resistance
- Foam padding for comfort
- Extended coverage to protect against pedal strikes
For riders seeking maximum protection against both crashes and pedal-related injuries, knee/shin pads are an excellent option.
Choosing the Right Size for Your Mountain Bike Pads
Proper sizing is crucial for ensuring your knee and shin guards provide optimal protection and comfort. Most manufacturers offer pads in small, medium, and large sizes, based on leg circumference measurements.
How to Determine Your Pad Size
- Consult the manufacturer’s sizing chart
- Measure the circumference of your leg at the specified points
- Compare your measurements to the size ranges provided
Is trying on pads in person the best way to ensure a proper fit. While sizing charts are helpful, individual body shapes can vary. Whenever possible, visit a local bike shop to try on different pad styles and sizes before making a purchase.
Materials Used in Mountain Bike Knee and Shin Guards
Mountain bike knee and shin guards utilize a combination of materials to provide protection, comfort, and flexibility. Understanding these materials can help you make an informed decision when selecting your gear.
Common Materials in Knee and Shin Guards
- Neoprene: Provides flexibility and comfort
- Plastic: Offers rigid protection against impacts
- Foam: Absorbs shock and enhances comfort
- Velcro straps: Ensure a secure fit
Advanced pads may incorporate specialized materials that harden upon impact, offering enhanced protection while maintaining a low profile during normal riding conditions.
Key Features to Consider When Choosing Mountain Bike Pads
Selecting the right knee and shin protection involves considering several factors beyond just coverage area. Here are some key features to evaluate:
Protection Level
Do you need light protection for trail riding or heavy-duty guards for downhill racing. The level of protection you require will influence your choice:
- Thin foam: Suitable for light trail riding
- Thicker foam: Offers more protection for aggressive trail riding
- Impact-hardening materials: Provide advanced protection while remaining flexible
- Hard plastic: Ideal for downhill and freeride applications
Strapping Mechanism
The way pads secure to your legs can significantly impact comfort and performance. Consider the following:
- Strap placement: Ensure straps don’t rub or chafe during pedaling
- Adjustability: Look for pads with multiple adjustment points for a custom fit
- Sleeve design: Some pads use neoprene sleeves instead of straps for a snug, comfortable fit
Ventilation
Proper airflow can make a significant difference in comfort during long rides. Look for pads with:
- Breathable materials
- Strategically placed vents
- Moisture-wicking properties
Price Range and Features of Mountain Bike Knee and Shin Guards
Mountain bike knee and shin guards are available at various price points, each offering different features and levels of protection. Understanding the price-to-feature ratio can help you make an informed decision.
Entry-Level Pads ($25-$65)
At this price range, you can expect:
- Basic knee-only and knee/shin designs
- Hard plastic or foam impact protection
- Limited size options
- Basic strapping systems
Mid-Range Pads ($65-$100)
Moving up to this price bracket offers:
- Greater variety in styles and designs
- Improved comfort features
- Neoprene sleeve options for a more secure fit
- Enhanced ventilation
Premium Pads ($100-$150)
Top-tier pads provide:
- Advanced impact-hardening materials
- Optimal balance of protection and comfort
- Superior ventilation and moisture management
- Customizable fit options
Is spending more on knee and shin guards always necessary. While premium pads offer advanced features, many riders find mid-range options provide an excellent balance of protection, comfort, and value.
The Importance of Product Reviews in Choosing Mountain Bike Pads
Before investing in a pair of knee and shin guards, it’s crucial to conduct thorough research. Product reviews can provide valuable insights that may not be apparent from manufacturer descriptions alone.
Benefits of Reading Product Reviews
- Real-world performance feedback
- Insights into durability and long-term use
- Comparisons between similar products
- Identification of potential issues or drawbacks
Where can you find reliable product reviews for mountain bike knee and shin guards. Consider the following sources:
- Specialized mountain biking websites and forums
- Online retailers with verified purchase reviews
- Mountain biking magazines and their online platforms
- YouTube channels dedicated to mountain bike gear reviews
After purchasing and thoroughly testing your knee and shin guards, consider leaving your own review to help fellow riders make informed decisions.
Additional Resources for Mountain Bike Protection Information
While this guide provides a comprehensive overview of mountain bike knee and shin guards, there are additional resources available for those seeking more in-depth information or specific advice.
Online Forums and Communities
Mountain biking forums are excellent places to connect with experienced riders and get personalized advice. Popular forums include:
- Pinkbike
- MTBR (Mountain Bike Review)
- Reddit’s r/MTB community
Local Bike Shops
Your local bike shop is an invaluable resource for:
- Hands-on product demonstrations
- Expert advice tailored to your local terrain
- Fitting assistance and size recommendations
- Information on local riding conditions and protection requirements
Manufacturer Websites
Visit the websites of leading knee and shin guard manufacturers for:
- Detailed product specifications
- Size charts and fitting guides
- Technology explanations
- Warranty information
By utilizing these resources in conjunction with the information provided in this guide, you’ll be well-equipped to choose the perfect knee and shin protection for your mountain biking adventures.
Maintenance and Care for Mountain Bike Knee and Shin Guards
Proper maintenance of your knee and shin guards is essential for ensuring their longevity and continued effectiveness. By following a few simple care guidelines, you can keep your protective gear in top condition for many rides to come.
Cleaning Your Knee and Shin Guards
Regular cleaning helps prevent odor buildup and maintains the integrity of the materials. Follow these steps:
- Remove any loose dirt or debris with a soft brush
- Hand wash in cool water with mild soap
- Rinse thoroughly to remove all soap residue
- Air dry away from direct sunlight
Can you machine wash mountain bike knee and shin guards. While some models may be machine washable, it’s generally best to hand wash to prevent damage to protective elements and straps.
Inspecting Your Gear
Regularly inspect your knee and shin guards for signs of wear or damage:
- Check for tears or cuts in the fabric
- Ensure all straps and fasteners are secure
- Look for cracks or deformities in hard plastic components
- Assess the overall fit and adjust as necessary
Storage Tips
Proper storage can extend the life of your protective gear:
- Store in a cool, dry place away from direct sunlight
- Avoid compressing or folding pads for extended periods
- Use a breathable gear bag to prevent moisture buildup
By implementing these maintenance practices, you can ensure your mountain bike knee and shin guards remain effective and comfortable for many rides to come.
Mountain Bike Knee/Shin Pads – Reviews, Comparisons, Specs
How to choose mountain bike knee/shin pads: As many of us learned early on, mountain biking is a recipe for skinned knees and scrapped shins. It is possible to pick a mountain biker out of a crowd simply from the scars of past bicycle mishaps. Thanks to modern knee and shin protection, those scars may be a thing of the past. There are a wide variety of styles and types available to satisfy all types of riders: from hard plastic knee/shin pads designed for hardcore freeriders, to thin foam knee pads for the cross-country enthusiast. No matter the type of riding, there is surely a set of pads out there to keep you safe.
Types
Lower leg pads are available in two types: knee pads and knee/shin pads. Knee only pads provide the best protection against big impacts to the knee joint, provide great freedom of movement and seldom move around. Riders seeking ultimate protection against big impacts or great comfort while pedaling may want to look into knee only pads.
Knee/shin designs protect a much larger portion of the leg from both crashes and errant pedals. They usually have a hard plastic shell combined with some foam for comfort.
Sizes
Most pad manufacturers make small, medium and large pads. The sizing difference is based on the circumference of a rider’s leg. Most companies have a sizing chart to help choose the right size, however, as not all bodies are shaped the same, trying the pads on in person is the best way to ensure proper fit.
Materials
Knee and shin pads use a combination of neoprene, plastic, different types of foam and velcro straps to help keep legs safe.
Things To Look For
The first thing to think about when shopping for a set of pads is whether you want to protect just the knee, or the knee and shin. Once that is done, the level of protection you want is the next thing to look into. Pads range in protection from thin foam, to thicker foams, to special materials that harden on impact, to the tried and tested hard plastic design.
Trail riders and light duty freeriders may want something with less bulk, like a foam or hardening compound pad whereas downhillers tend to wear either a hard plastic or downhill specific model equipped with special impact resistant padding. Be sure to consider the strapping mechanism and locations before purchasing, as the straps will likely run your leg while riding.
How Much To Spend
Knee/shin pads range in price from $25 to $150.
In the $25-$65 range, pads are available in both knee only and knee/shin designs. They use either hard plastic or foam to absorb impacts and come in all sizes.
Moving up to the $65-$100 range, many different styles of pad become available from slide-on pads with neoprene sleeves to heavy-duty plastic knee/shin protectors. The extra money spent allows for much greater selection, which is essential to finding the right pad for you.
Finally, the $100-$150 range combines all of the available types and styles of leg protection, but adds the option of foam that hardens.
This technology allows pads to be thin and comfortable, but still provide great protection from big impacts.
Product Reviews
Before buying, be sure to do your research and read product reviews. Reviews are a great way to find out specifics about a particular model, user impressions, and things to watch out for. After you’ve purchased a product and had enough time to thoroughly test it, we encourage you to leave a review for other people to see when they are researching bikes and parts on the web.
We hope you’ve found this information to be helpful. If you have a question that isn’t answered in this guide, our mountain bike forums are a great place to get advice from knowledgeable riders. Your local bike shop is also a great resource.
Protectors Knee/Shin Protectors Online Shop
IXS
Flow EVO+ – Knee Protectors
IXS
Trigger – Knee Protectors
Amplifi
Havok Zip – Knee Protector
Race Face
Roam – Knee Protector
ION
K_Pact – Knee Protector
ION
K_Pact_Zip – Knee Protectors with Zipper
ION
BD_Socks 2.
0 – Socks with ankle/shin guard
colour: black
size: 43-46
POC
Joint VPD Air Knee – Knee Guard
POC
Joint VPD 2.
0 Knee
FOX Head
Launch D3O – Knee- and Shin Protectors
FOX Head
Enduro D3O – Knee Protectors
POC
Oseus VPD Knee – Knee Protector
FOX Head
Launch D3O – Knee Protectors
IXS
Flow Evo + E-Bike Edt.
– Knee Protector
FOX Head
Launch Pro D3O – Knee Pad
FOX Head
Enduro – Knee Protectors
ION
K_Traze Amp (Zip) – Knee Protectors
IXS
Hack Evo – Knee Guard
Race Face
Ambush Knee D30 Stealth
POC
Joint VPD System – Knee Guard
ION
K_Pact_Select – Knee Guards
TSG
Temper A 2.
0 – Knee/Shin Guard
IXS
Carve Evo+ – Knee Protectors
IXS
Flow ZIP – Knee Protectors
Protectors Knee/Shin Protectors Online Shop | Bike-Discount
11 Best Motorcycle Knee And Shin Guards of 2021
If you do not have time to go through thousands of reviews and just want to know which are the best shin guards for motorcycles, this brief paragraph will tell you everything you need to know.
We have researched online, reviewing user reviews, sales figures and the value of many products on the line.
Ultimately, we have discovered that Shift Racing Enforcer is the best alternative because it offers all the protection one could need in the area of the shin and is relatively easy to set up thanks to its double elastic straps.
In addition, this is one of the most comfortable motorcycle leg protection we have discovered since it has a ventilated foam padded backrest and allows users to feel no pressure in the protected area.
If the Shift model is not available, you can confidently choose Troy Lee Designs KGL 5450 as it is almost as good.
Checkout Best Motorcycle Knee And Shin Guards
| 11 Best Motorcycle Knee And Shin Guards | Current Price |
|---|---|
| Fox Racing Launch Safety BMX MTB Knee/Shin Pad | |
| Leatt AirFlex Pro Knee Guard (Black, Large) | |
| Leatt C-Frame Pro Carbon Knee Braces-L/XL | |
| Leatt 3DF Hybrid Ext Adult Off-Road BMX Cycling Knee & Shin Guard | |
| Alpinestars Men’s Moab Knee/Shin Guard | |
| Alpinestars Vector Pro Knee/Shin Protector | |
| SCOYCO Motorcycle Knee Protector Guard | |
| Demon D3O Hyper Knee/Shin Mountain Bike Knee Pads | |
| Shift Racing Enforcer | |
| Troy Lee Designs KGL 5450 | |
| Shift Racing Enforcer Motocross |
Top 11 Best Motorcycle Knee And Shin Guards Reviews For 2021
1.
Fox Racing Launch Safety BMX MTB Knee/Shin Pad
With the patented strapping system X up, riding your bike at high speed is much safer. This motorcycle armor is made of excellent quality materials that can effectively protect the knees. It has a rigid ribbed lid that is combined with shell-shaped shin guards.
In addition to being made of superior quality materials, the Fox Racing Launch Safety Safety Knee / Shin BMX pad also offers ventilated breathability. The bioventilated soft foam frame helps you stay cool and comfortable, regardless of the type of motorcycle sport you practice.
The general design of this motorcycle kneepad makes it one of the best selling products on the market today. He has riveted the fox’s head logo and has some fantastic cuts that outline it. If you are looking for a fresh but durable knee brace, there is no reason not to buy BMX MTB Fox Racing Launch Safety knee pads / shin guards. Its durability and hard cover guarantee safety and protection.
In addition, its strapping system also ensures a firm grip, to keep it in a good position, regardless of how you drive.
Pros
- Made from superb quality and durable materials
- Excellent full knee protection
- Vented bio-foam chassis for extra cool and comfort
Cons
- Many suggested that the Velcro strap should be placed on the upper leg
- Some users complained of sizing problems
Check Price
2. Leatt AirFlex Pro Knee Guard (Black, Large)
The Leatt AirFlex Pro kneepad has been used by countless motorcycle enthusiasts worldwide and can give you many reasons to choose this model. First of all, the three-dimensional design of this product guarantees an excellent fit. It has been designed to adapt anatomically to the structures of the knee and shin. Its pivot points are also a great advantage, as it offers maximum protection.
If you want a super thin, resistant and comfortable protection profile, this particular knee brace is specially made for you.
It has an ultra-thin armor gel that absorbs impacts, which makes it cooler and more comfortable to wear. Breathable MoistureCool fabric and its silicone lamination keep the bearings in the right place without being annoying.
This CE certified knee protector for impact protection is undoubtedly one of the best items you can find online today. Its external protective housing manufactured by the renowned company Leatt has been tested and tested to offer comfort and protection. In addition, the top and side of this model increases protection.
Pros
- Incredible 3-dimensional design
- Anatomically correct dual pivot points
- CE certified for impact protection
- High-Density Poly Ethylene hardshell for added protection
Cons
- Price can be quite expensive for some people
Check Price
3. Leatt C-Frame Pro Carbon Knee Braces-L/XL
Another reliable and reliable motorcycle knee pad that you can find today are the Leatt C-Frame Pro carbon knee pads.
It is a single-zipper or clamp knee pad that gives you an excellent motorcycle feel. The overall design of this product also makes it one of the best-selling knee pads of all time.
In addition to its extraordinary design, this particular product also has CE certification for impact protection. This medically certified knee pad is made with a very sturdy metal equipment designed with two points of articulation, which allows you to replicate the natural movement of the knee.
The 3-point force distribution of this product offers greater comfort. It also reduces the forces and friction that help protect the knees from injuries like MCL, Meniscus and LCA. This medically certified product also offers an external metal hinge for precise and more natural movement.
Pros
- Allows you to move freely
- Great motorcycle feel due to very low profile
- Lab tested and medically certified
- 3 point force distribution for extra comfort and protection
Cons
- The price can be quite expensive
- Sizing can be a problem
Check Price
4.
Leatt 3DF Hybrid Ext Adult Off-Road BMX Cycling Knee & Shin Guard
The knee and shin protector for off-road cycling for adults Leatt 3DF Hybrid Ext is certainly one of the best knee pads you can find on the market today. This product features a full length shin and a new improved hard shell sliding shin. For this reason, you can expect excellent product protection. You can also enjoy the peace of mind of knowing that it offers superior shock absorption characteristics.
Nor should we worry about the fare and the comfortable movement, as its cushions are well attached to the body. It is also one of those ventilated knee pads that give the ride great movement and comfort. Furthermore, this protective equipment does not sleep easily, regardless of where you go or how you ride your bike.
It offers a new non-slip calf band and a reliable silicone lining. This incredible knee pad is non-slip and can be securely attached to the knees without sweating or feeling any discomfort.
This is definitely done for those looking for knee pads that can hug the knees and effectively help prevent any knee injuries caused by riding.
Pros
- Lightweight
- Easy to fastened and comfortable hugs your knees
- Top-grade cushioning system
- Breathable cloth for extra cool – also prevents sweating
Cons
- Some users reported that the inner Velcro straps are too short
Check Price
5. Alpinestars Men’s Moab Knee/Shin Guard
Made by a reliable and reliable company, the Moab Alpinestars shin guards / shin guards for men offer excellent protection to all its users. It is one of those well-built and well-designed knee pads that offer a high level of strength and flexibility.
Thanks to its low-profile design, driving your bike becomes more fun and interesting. Now you can move freely thanks to this fantastic design.
Moreover, the slim design of the profile gives the right a close fit that allows a lot of mobility or movement.
Anyone looking for knee pads with a low-profile design will find that the Alpinestars Men Moab knee / shin protector is a worthy investment.
It has an excellent system of adjustable straps and, at the same time, it is CE certified. Many users have also stated that the product lasts many years and uses.
Pros
- Outstanding comfort
- High-grade materials were used for construction
- Allows excellent mobility and movement
Cons
- The design is boorish for some users
Check Price
6. Alpinestars Vector Pro Knee/Shin Protector
The search for durable and reliable motorcycle knee pads is easier these days thanks to the Internet, however, finding a model that offers lightweight and highly flexible features can be very difficult.
Fortunately, the Alpinestars Vector Pro kneepads / shin guards can offer you everything you want on a knee brace. It is very light, although its materials are durable and extremely durable.
It has a breathable rip-stop that offers great breathability.
Thanks to PE foam and polyethylene mesh, this CE certified knee / shin protector has become one of the most sought knee pads in 2019. You will also appreciate its progressive protections and soft skin contact. This should make your bike safer and more comfortable than ever.
One of the many things that make this particular product stand out is that it has an enveloping design that offers perfect compression adhesion. It has excellent soft tissue support for all driving styles. Regardless of the type of motorcycle sport in which you are practicing or participating, you should definitely not miss the Alpinestars Vector Pro knee and shin protector.
Pros
- CE certified
- Lightweight and highly flexible
- Progressive protection
- Integrated soft shell
- Form and comfortable fit and compression
Cons
- Some users claimed that shipping takes several days and can reach up to more than just a week.
Check Price
7. SCOYCO Motorcycle Knee Protector Guard
It has been shown that the knee protection of the SCOYCO motorcycle absorbs severe shocks. The PP protective cover helps protect the anterior tibial. The intermediate transparent housing can withstand a great impact. The design itself has been designed for maximum impact resistance. This means that you can drive all day without worrying about the brace you give up.
In addition to being made of excellent quality materials for better protection, the SCOYCO knee protector also offers a lot of freedom of movement. The mobile design allows the joints to rotate from 30 to 180 degrees, according to the needs. This product also offers an excellent adjustable buckle strap and has an invaluable ventilation function that allows for better breathability.
The kneepad itself looks attractive and attractive. But what is more desirable than this product is that it has an excellent ventilation system with wire mesh on the side of the knee protectors.
This offers more comfort. In addition, the SCOYCO motorcycle kneepad is also sold at a very reasonable price.
Pros
- Top-notch protection
- Great adjustable elastic strap
- Promotes free movement
- Comfortable ventilation design
Cons
- The design might not be that appealing for some people
Check Price
8. Demon D3O Hyper Knee/Shin Mountain Bike Knee Pads
Last but not least, the Demon D30 Hyper Knee / Shin Mountain Bike knee pads. This high quality kneepad has excellent perforated neoprene that greatly improves ventilation and moisture control. It also has a soft mesh panel inside the knee to ensure that the legs remain fresh and comfortable.
You will also like the Kevlar front protector of this product that helps prevent injuries caused by contact with solid and dirty rocks. Another interesting thing about this product is that it has braided upper elastic comfort straps that prevent it from falling.
If you are the type of cyclist who wants to use cooler knee pads, then the Hyper Knee / Shin Demon D30 mountain bike is the best option for you. He is known for offering excellent comfort regardless of where he rides a bicycle. It is also one of those exceptional knee pads that can absorb strong blows.
Pros
- Unique venting and moisture control
- Elastic comfortable straps
- Can efficiently absorb shocks from rocks and dirt
Cons
- Can be a bit pricey for some people
Check Price
9. Shift Racing Enforcer
Since its launch in 2012, this model has been on the lips of motorcyclists around the world. The product takes the cake when it comes to safety, bearing in mind that it has been built with a high impact plastic casing.
In addition, it comes with all the features that one could ask for in a motorcycle shin guard. From the padded backrest with ventilated foam to a pivoting two-piece design that manages to adjust to the cyclist’s movement, whatever; the Shift Racing Enforcer has it.
In addition, the double elastic adjustment straps make it easy for users to easily customize the products according to their physical characteristics. More than a hundred and forty people took the time to write positive comments from Amazon regarding the quality and convenience of this alternative. It seems to be well regarded for the value it offers for the price.
Pros
- These shin guards provide a secure fit
- It has double elastic adjustment straps
- These black shin guards also have Velcro fasteners
- Innovative two-piece pivoting design
- Ventilated foam that forms the padded backrest
- Ensures comfort so that the protective cover does not cause pain
- It has an abrasion-resistant joint to keep the shin guards in place
Cons
- According to one user, this product could have been better if it had come with a strap on top, which is used to tighten the knee area.
Check Price
10.
Troy Lee Designs KGL 5450
The Shift Racing Enforcer and the Troy Lee Designs KGL 5450 differ on many levels. This second best option can be a bit difficult to choose since it is not a universal shin guard and requires accurate measurement by the person trying to use it.
Starting today, the unit can be purchased in sizes ranging from extra small to large. In addition to the lack of convenience that comes with the sizing process, the model has many undeniable advantages.
For example, the KGL 5450 is very convenient to use and relatively easy to put on. As for security, although there may be better options, the KGL 5450 still does a good job on this account. The model has a stratum foam that is able to articulate with the areas that require the greatest amount of body protection. The reviewers characterize the product as comfortable and incredibly light.
Pros
- Suitable for motorcyclists
- This shin guards are equipped with the patented Shock Doctor technology
- Feature a wraparound support combined with an elastic mesh sleeve for reliable comfort and fit
- Built with Strata foam
- This shin guard is articulated with the complex areas of the body
- The shin guards also have the integrated Vent-trak system that propels the air through revolutionary flexible channels.
Cons
- Care should be taken so that the thread does not fall apart when the shin guards are washed.
Check Price
11. Shift Racing Enforcer Motocross
As is the case with the other Shift Racing option we have shown above, this comes with all the advantages of a high-end product. On the one hand, it makes it easier for motorcyclists to attend to their activity without worrying about the quality of their protection.
Secondly, it is easy to put on and comfortable so that it does not interfere with the whole experience and does not diminish the amount of fun the user feels while traveling on his motorcycle.
Like the aforementioned model manufactured by the same brand, it has a back that has abrasion-resistant joints. As far as the amount of critical praise collected by this unit is concerned, it might be worth noting that it does not even come close to the appreciation of 10010533. While it may not have the same excellent characteristics, this model is the trick.
He does the work and is strong and comfortable enough for many people to get rid of him.
Pros
- These shin guards help biker prepare better for any eventuality on the trail.
- These shin guards are an exciting part of your biker outfit
- The high impact plastic shell provides a high level of protection
- It has innovative two-piece pivoting design for free movement of the legs
- It will not bite the skin on your legs and cause pain, bruising or cuts.
Cons
- In order not to make the straps fall on the upper part of the calf, care must be taken to tighten them sufficiently but not too much.
Check Price
Features To Consider When Buying Motorcycle Knee Guards
Buy dirt bike shin guards these days can be quite an adventure. After all, the market is full of products and new ones are coming out every year.
If you want to make the best call, take a look at the following guide that we have gathered for your consideration.
Do not forget to read all the information you may stumble upon in order to make an informed decision.
1. Type of protection
The shin guards for serious motorcyclists do not have the appearance or design of those that are now used in various sports, such as football. On the contrary, they have a heavier construction and are sometimes made of high impact materials that can withstand the collision with the ground in the event of an accident.
The best shin guards for motorcycles can be divided into two categories: knee pads and knee pads. During your shopping trip, you will see that even though it is called ‘knee protection’, the product is also long enough to cover your shin.
The guards are full coverage products, as they do an excellent job of protecting the entire area that could be injured. The only drawback of choosing this type is that they can keep the knee area and the shin a bit hot.
The knee pads are mainly focused on keeping the knee in the correct position so that the kneecap does not move due to a rupture of ligaments or anything else that may occur during an accident.
It is up to you to choose the right one, but for security reasons, we recommend the full coverage alternative.
2. Safety
As we mentioned earlier, some products may be safer than others. Knee pads are simply better than their counterparts because they can protect the entire area, including the user’s skin.
If you have trouble understanding if the product you want to buy is safe enough to use, simply review some of the best reviews of motorcycle shin guards and discover the opinions of other buyers.
3. Ease of use and comfort
It goes without saying that the protectors you end up choosing should be comfortable and comfortable to wear. Some have breathable foam, while others are made with artificial materials.
In addition, the straps used to hold the units in place must be efficient and customizable so that they do not exert too much pressure on the shin area and damage local circulation.
Buy From Amazon
Related Post:
Best Snowmobile Helmets 2021
20 Best Motorcycle Helmet of 2021
Top 5 Motorcycle Riding Boots And Shoes In 2021
Best mountain bike knee pads: protect your patellas people!
Seven of very, very best mountain bike knee pads. Hard or soft? Pull-on or wrap-on? Which brands make the best? Here’s all you need to know.
We’ve whittled down the plethora of available pads to this summation of the best mountain bike knee pads, with a select few pairs striding away with the honours. Whether you like flying down steep, technical trails, or you prefer a more sedate pace, some form of knee protection while riding is a good idea. Even the best, or most careful riders, make mistakes and, while not all accidents end up with a trip to A+E, the last thing you want is to curtail a ride because you’ve gashed a knee open.
We realise wearing knee pads is a personal choice, but think of them as an insurance policy for you and your mates – no one wants a trip to casualty. At the end of the day good knee pads should behave like the best mountain bike helmets, in that you quickly forget you’re wearing them once you start your ride.
When buying your first set of pads you could go for a heavy duty nee/shin, which extends all the way from the knee to the ankle. This offers the most protection, but if you’re pedaling all day, this style of pad can get pretty hot and uncomfortable. For trail riding, we’d recommend a lighter-weight design. Most still have a reinforced pad to shrug gravel rash and small impacts, but they’re more comfortable and don’t get as clammy when you turn up the heat.
Best mountain bike knee pads
Knee pads are standard apparel these days
How we tested the best mountain bike knee pads
Comfort is a key consideration when wearing a knee pad, and the only way tp p[ut this to the test is to use alt he pads on all-day trail rides, involving extensive climbing and descending. During test rides we made a note of any chaffing or soreness, and whether the pad stayed in place. We also kept an eye on durability because pulling the pads on and off can put extra stress on the lightweight material, especially at the upper seam. All the sample pads are medium size and the weight listed in the specification is for a pair.
‘View Deal’ links
You will notice that beneath each of the best mountain bike knee pads product summary is a ‘View Deal’ link. If you click on one of these links then mbr may receive a small amount of money from the retailer should you go to purchase the product from them. Don’t worry, this does not affect the amount you pay.
7iDP Sam Hill
7iDP Sam Hill
Winner!
Price: £79.99 | Weight: 341g | Sizes: S to XL
Pro: Very supportive. Possible to self-tune with removable inserts.
Con: Need to remove Sastec inserts before washing. Warmer than you might think.
The overall fit of the Sam Hill is super snug and never slipped down during testing. 7idp is offering the Sam Hill in four sizes and with the silicone/mesh back it’s very easy to pull on. This mesh also seems a lot more durable – a lot of lightweight knee pads we’ve tested eventually rip at the calf as you pull them on and off. With its mesh construction and perforated Sastec bumper, the Sam Hill is lightweight but it does run pretty warm. That’s okay for this time of year but high summer you’re going to sweat a bit than some. That said, for a knee pad that fits this good and offers the right amount of protection for everyday trail riding, it’s a small price to pay.
Read our full test review of the 7iDP Sam Hill knee pad
Alpinestars Paragon
Alpinestars Paragon
Best value
Price: £45
Pro: Very well made despite value price tag
Con: More expensive than it used to be
With its profiled pad and flat, inward-facing, internal seams the Paragon is pretty plush and also doesn’t slide around too much while pedaling. However, the bottom edge of the Lycra does tend to bunch up after a while, causing the edge of the knee pad to rub on the shin area – it’s almost as if there’s a lack of support in the mesh material. The thin mesh is also prone to tearing and there are already few nicks at the back of the calf, where we’ve snagged a pedal, and several scuffs over the knee. We’ve awarded the Paragon top marks in past tests because it’s packed with features, feels comfortable on the bike, comes in a ton of sizes and is great value. It’s seen price hikes recently, but it’s still the best value pad on test;. we just felt the 7iDP Sam Hill was harder wearing and more comfortable.
100% Surpass Knee Guard
100% Surpass Knee Guard
Best premium pad
Price: £129.99
Pro: Our current favourite pad of choice
Con: Money money money
The 100% Surpass is one of the burlier kneepads out there, rated to CE Level 2 it’s designed to absorb maximum impact force. Protection starts with a hard plastic shell sitting over your kneecap, backed up by a layer of squishy foam on the inside next to your skin. Coverage is extended all around the shell with chunky foam padding, giving you more square footage of protection than most pads on the market, particularly on the inside where you’re most likely to whack your knee into the bike. The best pad in the world is no good if it moves around in a crash or slips down when you ride, but 100% has nailed it here too – the Surpass stays put beautifully, with rock-solid stability that glues it to your knees. The protection is as good as it gets too, nowhere on the Surpass is lacking foam or cushioning, and the extended coverage down your shin and around the sides of the knee is particularly cheering. It’s a superb pad, if a little pricey.
Read review of the 100% Surpass Knee Guard
Scott Mission Evo
Scott Mission Evo
You’ll barely know you’re wearing them
Price: £59.99 | Weight: 122g | Sizes: S to XL
Pro: Superlight and super stable
Con: You may want more protection for more extreme terrain
The Scott Mission Evo knee pads are the lightest and most discrete design we’ve ever tested. So flighty you won’t even know you’re wearing them, they actually cover a decent section of the knee, with extended padding over the top of the shin. Remarkably stable thanks to broad bands and dotty silicone dimples, the Mission Evos may not be best suited to a scorpion into a rock garden, but they’re a great solution for trail rides where you want protection and absolute freedom of movement.
Read our full test review of the Scott Mission Evo pads
Hebo Defender
Hebo Defender
Size up and you’ll be fine
Price: £46.00 | Weight: 322g | Sizes: XS to XXL
Pro: Good comfort at a good price. More of padded knee warmer than full-on protection.
Con: More of padded knee warmer than full-on protection. Skinny fit.
If you’ve never heard of Hebo, don’t worry – neither had we until recently. The Spanish brand is well-known in motocross and moto trial circles, but it’s making a big push into mountain biking with a full range of clothing and protection pieces. The light weight meaning it’s ideal for quick evening spins or long days in the saddle when you want a bit of protection without making pedaling an uncomfortable chore. The four-way stretch material keeps freedom of movement high, while the perforated memory foam pads stopped me from cuts and grazes on the few times I’ve crashed wearing them. Silicone grippers top and bottom do a decent job of holding the Defender in place, but you’ll need to size up for a good fit.
Bluegrass Skinny
Bluegrass Skinny
Minimalist design is a bonus
Price: £49.00 | Weight: 237g | Sizes: S to XL
Pro: Light and minimalist
Con: Some leg-creep
The Skinny wouldn’t be our first choice for bike park riding, where consequences are more serious, but then that’s not its remit. For most normal riding the stable and comfortable design make it one of the best lightweight pads on the market. There are no adjustable straps to hold the Skinny in place, but the cut of the thin, well-ventilated mesh sleeve, coupled with bands of silicon at the top and bottom, keep the Skinny locked in place under most circumstances. Like many other pads of this type there is always a little bit of downward creep under prolonged pedaling. But thanks to the additional stabilising band of elastic situated at the top of the calf and its lower slathering of silicon it refuses to migrate south.
Read our full test review of the Bluegrass Skinny knee pads
Sweet Protection Knee Guards
Sweet Protection Knee Guards
One of the most comfortable
Price: £58.99 | Weight: 226g | Sizes: XS-XL
Pro: Good fit and flexibility
Con: Sas-Tec pad is not removable, so hand wash only
Sweet Protection’s Knee Guard is the lighter of its two offerings and is essentially a simple sleeve. There’s a viscoelastic pad over the knee cap that remains flexible in normal use but hardens in an impact, and the fit, although strange at first, works well, with a tight cuff around the thigh and looser fit at the calf. The pad isn’t removable, so retain its properties Sweet Protection recommends hand washing, which is a pain, but the Knee Guards are a good length and its easy to forget you’ve got them on.
Read our full test review of the Sweet Protection Knee Guard
Front and back views
What to look for in best mountain bike knee pads:
Gripper
To stop unwanted movement, knee pads use a silicone gripper or an elastic hem, like you’d find in a pair of Lycra shorts. Silicone tape can cause a bit of soreness so what feels comfy in the shop may not after a few hours riding.
Size specific
Knee pads are either left and right specific or can be worn on either leg. There’s often a label inside telling you want pad goes on what knee. If in doubt, go for the configuration that shows the brand logo on the outside of the legs, as that’s often the way they’ve been deliberately designed.
Breathability
Cutaways at the back of the knee stop rubbing of the ligaments and also increase air flow. On some designs the kneecap is also left uncovered or has a honeycomb/perforated surface to channel air directly over the knee.
Smart materials
The protective cap used in most of the knee pads is often an impact-resistant foam, but some use hi-tech materials, such as D30 or Armourgel. These stiffen under impact and reduce the amount of force felt at the knee. Smart material are lighter but they are ore expensive.
Chassis
To reduce weight, the base material for the majority of knee pads is either Lycra or a thin neoprene. A Kevlar cover is often placed over the knee area to increase scuff resistance.
Velcro strap
To really batten down the hatches some knee pads have an additional Velcro strap, either at the top or bottom. Look for a long strip of of Velcro and a strap that doesn’t bunch up or narrow as you pull it tights, which can cause it to dig in.
Protection
It’s best to think about knee pads in three different categories: lightweight, trail and heavy duty. The lightest pads are designed to offer abrasion protection at best, they sacrifice extra protection for breathability, low weight and breathability. Trail knee pads are the go to option for most of us, comfortable enough to ride all day in but tough enough to protect your patellas in a proper crash – at their best they’re lightweight and breathable and offers a good level of protection with malleable pads made from materials like D30 and Sas-Tec. Then there are enduro pads, better able to absorb impacts, they often have extended coverage down your shin, a plastic or TPU shell and offer maximum protection – the tradeoff is they’re often hotter to wear, stick out more and are less comfortable.
Know your riding
Get started by working out which is best for your kind of riding, there’s no point lugging around more material than you need to, pedaling in a pad that’s designed for downhill only. Mountain biking is fun, and we want to keep it that way. In the same vein, if you spend lots of time at the bike park it makes total sense to compromise on breathability and pedaling performance, so if you do hit the deck you’ll be able to bounce back up again without a trip to A&E.
Sizing
The best mountain bike knee pads in the world are useless if they’re not comfortable and you end up leaving them in the car. Plenty of what makes wearing a kneepad a nice experience is the fit, get this right and it’ll stay squarely in place when riding (or crashing), and ideally will be so unobtrusive as to disappear when you’re wearing it. Most brands give you a detailed fit guide based on thigh and calf diameter. Knee pads are available in overlapping (small/medium, medium/large) or single sizes such as small, medium and large. Individual sizes offer a better fit but as always it makes sense to try beforehand because they do vary between manufacturers.
Fit style
There are two types of fit, those that slip on via your foot like a sock, and those that fully open to strap around your knee. They both have advantages and disadvantages, slip on designs are generally lighter and less fussy but you do have to take you shoes off to don them. Fitted knee pads can be taken on and off when you need them on a ride, without having to take your shoes off. If your riding consists of one or two big ups lasting over an hour, fitted pads might suit you better, but if you’re constantly gradient hopping then something you fit and forget is the ideal.
Extended coverage
Kneepads vary in length from very short enough to just cover your knees, like the Sweet Protection, to long enough to slide under your chamois and still reach half way down your shin, like the 7idp Sam Hill Lite Knee. Why is this important? If you’re tall, longer pads are recommended, first to avoid the t@@t gap between your shorts and knee pads, and second so they actually fit your longer limbs.
Bionic Pro Knee/Shin Protector | Alpinestars
U.S. SHIPPING
Orders will generally be shipped within one (1) – two (2) business days after receipt of payment and depending on availability of goods.
All orders shipped at a flat rate cost of $9.99. Estimated delivery time is 2-5 days. Shipping companies do not guarantee a delivery timeframe.
For consumer protection, all orders are subject to review. On occasion, this may extend the processing time of your order. For questions regarding order, please call – (US) 1-800-409-0903 / (INT) +1-310-891-0222 / Email: [email protected].
INTERNATIONAL SHIPPING
We are currently only able to ship to addresses within the United States of America. Please contact your local Alpinestars distributor for details of your closest dealer.
Refused Shipments: If you refuse shipment of your order, you will be responsible for the original shipping costs, as well as any duties, taxes and/or customs charges that were incurred upon shipping the package. These expenses will be deducted from your order refund.
WHAT IS YOUR RETURN POLICY?
We guarantee our merchandise to be free of manufacturing defects. If an item you have received is defective, we will be glad to assist you with processing a refund. For help with processing your return, please contact our Customer Service team – (US) 1-800-409-0903 / (INT) +1-310-891-0222 or contact us here.
- Please be sure to check the fit and sizing of your product before removing tags. Products returned must have all original tags attached.
- Unwashed, unworn, unused merchandise may be returned within 30 days after receipt of product for refund (receipt date of products is determined based on tracking provided by shipping carrier)
- Alpinestars will not accept merchandise after 30 days.
- Product must be returned within 14 days once the Return Merchandise Authorization (RMA) is issued, and must be returned in original packaging with tags.
- Shipping charges will only be refunded if the item you have received is incorrect or damaged.
- Refund value is determined by the last retail price of the item.
- All merchandise sold on sale is final sale, and cannot be returned unless item received is damaged or incorrect.
- Returns will only be accepted with an RMA form.
- We do not accept returns or offer refunds on gift certificates (gift certificates do not have a cash value).
If the item you ordered becomes defective from wear and use, please contact – Product / Warranty Support team – (US) 1-800-438-2577 / (INT) +1-310-891-0222,
or contact us here.
CAN I RETURN AN ALPINESTARS PRODUCT THAT I ORDERED FROM ANOTHER RETAILER?
We do not accept returns on products that were not purchased from the Alpinestars.com website. If you ordered a product from another retailer, you may contact our Product / Warranty Support team – (US) 1-800-438-2577 / (INT) +1-310-891-0222, or contact us here.
WHERE DO I SHIP MY RETURN?
If you would like to make a return, please contact Customer Service to request an RMA form. The return address, along with directions, will be provided with the RMA form upon issuance. Please include the RMA form within the returned shipment. Returns will only be accepted with an RMA form. To request an RMA form, please contact – (US) 1-800-409-0903 / (INT) +1-310-891-0222, or contact us here.
HOW DO I SHIP MY RETURN?
Pack and seal your box securely, in the original packaging if possible. For boots and shoe returns, place the shoe box inside a shipping box. To ensure that your return package arrives to our warehouse successfully, Alpinestars suggests shipping your return package with a tracking number. Packages must be returned prepaid.
WHEN WILL MY CREDIT CARD BE REFUNDED?
Once Alpinestars receives your returned merchandise, your refund will be processed within 7 business days. If there is a refund due, a credit will be issued in the original form of payment. The credit may not show up until your credit card’s next monthly billing cycle. You will be notified via e-mail when this transaction has taken place. Please note that your banking institution may require additional days to process and post this transaction to your account.
POC Knee Pads | Knee Protection – POC Sports
Home /
Mountain Biking Armor | Knee Protection
VPD Air Knee Fabio Ed.
Regular price
€80,00
Outlet Sale Price
Color
Joint VPD 2.0 Knee
Regular price
€120,00
Outlet Sale Price
Color
Joint VPD 2.0 Long Knee
Regular price
€130,00
Outlet Sale Price
Color
Joint VPD System Knee
Regular price
€160,00
Outlet Sale Price
Color
POCito Joint VPD Air Protector
Regular price
€65,00
Outlet Sale Price
Color
VPD Air Legs
Regular price
€80,00
Outlet Sale Price
Color
Joint VPD Air Knee
Regular price
€80,00
Outlet Sale Price
Color
VPD System Lite Knee
Regular price
€140,00
Outlet Sale Price
Color
Oseus VPD Knee
Regular price
€140,00
Outlet Sale Price
Color
9 of 9 items shown
Baseball Catchers Shin Guards, Knee Guards, Knee Savers, Softball
When you’re behind the plate, you know you’re legs and knees can take a beating. Imagine trying to stop a missed pitch in the dirt without something protecting your knees! You’d be on the DL in no time. But the last thing you want is big, bulky catcher’s gear that protects but slows you down. After all, you need to get from your knees to your feet quickly to make that throw to second! That’s why Sports Unlimited only stocks the highest quality catchers gear, and catcher’s shin guards and leg guards on the market. Our selection of catchers leg guards from the top brands on the diamond like Nike, Rawlings, Mizuno, Easton, Under Armour, and All Star, all offer lightweight, durable protection with performance-ready materials and features.
All of our leg guards offer excellent coverage and tough protection. Higher-end, pro-level shin guards are typically lighter, stronger, more comfortable, and offer advanced technologies. But it’s not always the case that the most expensive leg guards are “the best” or the best for your game. To find the best catcher’s leg guards for you, it’s important to know what each offers, and how it protects you. This way, you can determine which leg guards fit your game, your skill, and your wallet.
The major difference between catcher’s shin guards is in the knee coverage. Some leg guards offer single knee coverage, which gives you one panel the fits over the knee. Others offer two panels, with one directly over the knee and another panel of protection right above the knee. Extremely high level shin guards offer triple knee protection, with three panels. The third is placed between the first and second, and covers the small space that is created between the knee and thigh panel when you crouch down. Your choice in knee coverage usually is based on personal preference and level you’re playing at.
It’s also important to understand the features offered by each shin guard, to figure out how your shin guards can improve your game. Most of our selection of shin guards are lined with moisture management fabric underneath the shell. This fabric keeps you cool and dry throughout the game. Some shells feature ventilation holes for additional breathability. Another feature to look out for are the buckles, or leg connectors, since some tend to be more stable or comfortable than others. Again, it is not always that the most expensive guards are the best. Be sure to browse all of our shin guards to find the one that’s right for you.
If you’re looking to round out your catcher’s gear set, make sure to check out our huge collection of catcher’s chest protectors and catcher’s helmets for youth, men, and women. With the right catcher’s gear, you can really take your game to the next level. So never short change yourself!
Page not found
SportRunningBicyclesYogaIce SkatesInline SkatesCross-Country SkisMountain SkisScootersSurfingSkateboardsSnowboardsTourism
CategoryEquipmentClothesShoesopticsProtectionAccessoriespartsTools
Adapter for refilling kartridzhaadapteryadaptery for fastening chehlaadaptery for pumping kolesaamortizatory rear for velosipedaaptechkibagazhniki avtobagazhniki for velosipedabazybalaklavyballony gas turisticheskieballony for pumping kolesabandanybandany mnogofunktsionalnyebatarei akkumulyatornyebliny vrataryabloki for yogibolty komplektbotinki vnutrenniebotinki for cross lyzhbotinki mountain lyzhbotinki for snoubordabotinki zimniebotinki with koshkamibotinki trekkingovyebryukibryuki korotkiebryuki legkiebryuki sportivnyebryuki termobelebryuki uteplennyevarezhkivarezhki with podogrevomvodra skladnyevelosipedy BMXvelosipedy begovelyvelosipedy mountain bikes electric mountain bikes cruiser bicycles walking bikes and velosipedavtulki komplektvyzhimki for tsepivynosy rulyagamakigamashigermetiki for kolosgermoupakovkigetrygidratorygirorotorygorelki turisticheskiegrebonkidatchiki for velokompyuteradatchiki serdtsebieniyadatchiki pedalirovaniyaderzhateliderzhateli speed velokompyuterovderzhateli for velosipedovderzhateli for flyagiderzhateli for schetkiderzhateli pereklyuchatelyaderzhateli handle pereklyuchatelyaderzhateli tormozovdetali for krepleniydiski for balansadiski for krepleniydiski brake for velosipedadoski training for skalolazaniyadoski trenirovochnyedoski training for skalolazaniyadugi set remontnyydushi pohodnyeemkosti for vodyzhiletyzhilety zaschitnyezhilety with heated vests rescue handlebar plugs rope clamps scooter clamps bookmarks mountaineering rivets locks luggage locks bike locks chain locks skate bracing hooks set suspension hooks ankle protectors ankle protectors chest protectors bushing protection star protection lenizaschita komplektzaschita loktyazaschita on zapyastezaschita on palkizaschita perazaschita plechzaschita podborodkazaschita predplechyazaschita frame komplektzaschita spinyzaschita shatunazaschita sheizvezdy for velosipedazvonkizerkala on rulinstrumenty komplektkabeli for velokompyuterovkamery for velosipedakamni abrazivnyekamusy for lyzhkamusy for splitbordovkantorezykarabiny alpinistskiekaretki for velosipedakarmany extra for palatkikartridzhi kit zapravkikartridzhi mnogorazovyekartridzhi disposable komplektkassetykassety for velosipedakastryulikedykepkiklinya for fixing remeshkaklipsyklyuchiklyuchi komplektklyuchi kit bicycles hockey sticks yoga mats repair set mats inflatable mats touring helmet visor helmet visors wheels bicycle wheels bicycle set longboard wheels roller skate wheels roller skate wheels set of scooter wheels set of wheels for scooters wheels set for scooters wheels for skate stems velosipednyekolodki brake obodnyekolonki steering velosipedakolyshkikoltsa for palokkoltsa for pilatesakoltsa prostavochnyekomplekt remontnyykomplekty for yogikomplekty for pumping kolesakomplekty for pilatesakomplekty for splitbordovkomplekty balls for therapy rukkomplekty transmission remontnyekomplekty for velosipedakomplekty ropes and shirts tormozakompyutery for velosipedakonki myagkiekonki rolikovyekonki figurnyekonki hokkeynyekorziny for velosipedakosmetika bicycle komplektkostyumykostyumy gonochnyekostyumy for plavaniyakostyumy sportivnyekoftykofty termobelekofty flisovyekoshelkikoshki ledovyekrepezhi for fins cross-country ski mounts alpine ski mounts snowboard mounts splitboard mounts backpack helmet mounts action cam mounts inflatable sneakers mugs fenders bicycle fenders bicycle fenders set cassette covers cassette covers steering column covers swimwear beach jackets lightweight jackets windproof jackets rtki puhovyekurtki with podogrevomkurtki uteplennyelampa turisticheskayalapki for paloklegginsyledobury alpinistskieledoruby alpinistskielezvie for konkovlezviya for konkovlenty for klyusheklenty obodnyelesenkilinzy spectacle maskalinzy solar ochkovlipuchkilishilozhkilongbordylongbordy minilopaty lavinnyelyzhi begovyelyzhi running komplektlyzhi gornyelyzhi mountain komplektmagneziya for skalolazaniyamagnity for velokompyuteramazi lyzhnyemaykimaskimaski vetrozaschitnyemasla for amortizatorovmasla for vilokmasla Brake sistemmebel camping komplektmeshki for magneziimeshki kompressionnyemeshki spalnyemiskimolotki rockyinstallationinstallation kitBalance BallsRaincapsSlip PadsHelmet Protective PadsSole Replaceable Pads Pole CapsSwitch ShirtsTipsBrake ShirtsDeshirt TipsBrake Cable TipsBrake Cable TipsBrake Cable TipsSleeve BracersBike Warmer PumpsBike Chain Tensioners and rulyaoboda for velosipedaoselki for konkovosiosi for vtulkiosi komplektotvertkiottyazhki alpinistskieottyazhki for palatkiochistiteliochistiteli for velosipedaochistiteli for tsepiochki maskiochki solntsezaschitnyepalatki turisticheskiepalki for cross lyzhpalki mountain lyzhpalki for lyzherollerovpalki Nordic hodbypalki trekkingovyepegipedali for velosipedapereklyuchateli velocity velosipedaperchatkiperchatki velosipednyeperchatki for cross lyzhperchatki with podogrevomperchatki hokkeynyepetli strahovochnyeplavkiplavnikiplastyriplatformy for krepleniyplatyaplity gas turisticheskiepovyazki on lobpodnozhki for bicycle cushions touring bearings set bike tirespolyrolol towels mat towels tourism tableware set touring dining tools impregnation set water-repellent impregnations deodorants impregnations set cross-country ski profiles rear shock absorber springs buckles roller scraper bars scraper frames for bicycle frames shki for kovrikovremeshki for ice instrumentaremeshki for palokremniremni for krepleniyarepshnuryroga on rulrolikirolly therapy stoprubashkirubashki pereklyuchatelyarubashki short rukavomrubashki tormozaruli for velosipedaruchki remote upravleniyaruchki for palokruchki pereklyuchatelyaruchki rulyaruchki tormozaryukzakiryukzaki for roller konkovryukzaki lavinnyesalfetki for ochkovsamokatysandaliisanki ledyankisvyazki for cross lyzhsedla for velosipedasetka for bagazhasetki mounts lampsetki moskitnyesidenya for transportation deteysidenya naduvnyesidenya pennyesistemy strahovochnyesistemy shnurovkiskakalkiskeytbordyskrebkislantsysmazki chain velosipedasmazki konsistentnyesmyvkisnoubordyspitsy for velosipedasplitbordysprei against zapotevaniyastakanystakany hokkeynyestekla for lampStelkistelki with podogrevomstendy to build velosipedastoyki for tentastoly turisticheskiestropy universalnyestulya turisticheskiestyazhki ekstsentrikovyestyazhki eccentric komplektsumkisumki for aptechkisumki for botinoksumki for verevkisumki for konkovsumki on bagazhniksumki on poyassumki on ramusumki on rulsumki podsedelnyesumki hokkeynyetarelkitenty turisticheskietermobele komplekttermosytopytormoza disk for velosipedatormoza for konkovtormoza for krepleniytormoza obodnyetreschotkitrosiki girorotoratrosiki pereklyuchatelyatrosiki tormozatrubkitrusy termobeletrusy hokkeynyetufli velosipednyetufli skalnyeudliniteli belt for ochkovuplotniteli for vizoraupory for ice instrumentaupory Rubber krepleniyauspokoiteli tsepiustroystva cleaning tsepiustroystva zaryadnyeustroystva negotiation komplektustroystva safety irons hand weights carabiners for carabiners for rings fasteners for sticks drinking flasksbike lights for bicycles lanterns for touring shirts collared shirts long sleeve shirts for bike saddle chains for bicyclescases for cross-country ski covers for bicycles covers for mountain skiing goggles covers for mountain skiing goggles covers zakachehly for snoubordachehly for telefonachehly for shlemachehly on botinkichehly on velotuflichehly on blade konkovshaybyshayby hokkeynyeshapkishapki for plavaniyasharfyshatunyshatuny komplektshezlongishipy for obuvishipy for shoe nasadokshipy pedal komplektshkurkishlemyshlemy velosipednyeshlemy skating on roller konkahshlemy hokkeynyeshnur for dugshnurkishnurki for konkovshnurki for ochkovshnurok for ochkovshortyshorty velosipednyeshorty zaschitnyeshtyri podsedelnyeschetkischetki komplektyschitkischupy lavinnyeekrany vetrozaschitnyeekshn-kameryelementy pitaniyaespanderyyubkiyakorya
30 seven360 DegreesActive LeisureAdidasAlexrimsAll TerraAlpinaAreaArisunAsicsATIAtomicAvidAxiomBakodaBataleonBauerBickertonBionBlackspireBladerunnerBlizzardBluesportBorealBraveBrikoBrooksBuddy ChatBuffBulaBulletBurtonCane CreekCannondaleCarreraCCMChanexChargeChilliChinookCicloCleaveClimb XClimbing TechnologyCloudveilCodebaCombatCorratecCouloirCraghoppersCrankBrothersCrowCSTCycledesignD2bDalbelloDCDia-CompeDiamondDiatechDRDrakeDT SwissDuffsDynastarE ThirteenEagleEasternEastonEclatEclipticEdeaEiderElementEmmegiEndeavorEnduraEskaEurotrailEVFExelFabricFerlandFirst StrideFischerFive TenFlashFOXFOX ShoxFreetimeFSAFunscooFuseGaiamGarmontGlobeGonsoGordiniGoSystemGroovstarGTHADHayesHeadHell is for HeroesHuckeHugerIcebreakerIndependentIndianaInnesIo BioIzjevskie KovrikiJamisJoytechK2KarrimorKEDKefasKendaKermaKidneykarenKMCL1LafumaLangeLazerLekiLelumiaLevelLicornLineLobsterLoloLookLooplineLowaMaceMach 1MadridMammutMangoManitouMankindMarkerMarzocchiMDCMedalistMerinopowerMetoliusMetropolisMichelinM icroSHIFTMilletMongooseMons RoyaleMotorexMRPNecoNHSNikeNirveNitroNomisNorcoNordicaNorthcapeNorthwaveO-SynceObermeyerOktosONE IndustriesOne WayOntarioOptiwaxOrageOutleapPallasPillarPOCPolaroidPowderhornPranaPremiumPrinceton TecPro FeetPro WheelPromaxPumaPure FixQloomRadioRaidenRebel KidzReebokRegattaReverseRexRichmanRideRiedellRisportRitcheyRockRockShoxRodeRoecklRollerbladeRome SDSRossignolRottefellaRoxyRSTRustySalomonSaltSamoxSauconySaxifragaSchoeffelSchwalbeScreamerSDGSea to SummitShimanoSinnerSixSixOneSkullcandySlegarSlideSmithSnoliSombrioSpeed StuffSportalmSPRISpringyardSpyderSR SuntourSramStarStencilStormSun ValleySunRaceSuper.NaturalSupraSwitchbackSwixTakeyaTaubertTechnineTektroTempestaTevaThawTiogaTisaTokoTorspoTrailsideTravelSafeTrekkoTrial-SportTruvativTSGTurtle FurTwentyTyroliaUbikeUFOUSD ProVansVettaVokulVPWall ActiveWarriorWASPcamWellgoWestbeachWeThePeopleWoodmanWTBX-FusionXposureYokoZeropointZippZootZycle FixZZYZX
2021/202220212020/202120202019/202020192018/201920182017/201820172016/201720162015/201620152014/201520142013/201420132012/201320122011/201220112010/201120102009/201020092008/200920082007/200820072006/200720062005/200620052004/200520042003/200420032002/200320022001/200220012000/200120001999/20001999
90,000 Deenside D266 / 264 Level 2 Knee & Shin Pads.sports protection martial arts shin guards shell Camouflage Military clothing and uniform NATO
Original.
Manufacturer: Police Warehouses (UK)
Condition: Used
Police guards to protect the knee and lower leg from injury. Consists of two modules.
The shields themselves consist of two layers. The outer layer is hard, about a millimeter thick and the inner one is soft from 0.5 to 1.5 cm thick, made of a material similar to foam.
This product is designed to provide protection without obstructing the movement of the body, protects against injuries that can be caused by thrown objects or blows with truncheons, poles, from simple blows, from fireworks, from anything that can be used against police officers in operational or training activities …
Level 2 protection has been shown to withstand loads complying with BS 7971-4L2.
They were rated as comfortable to wear over an extended period of time, ease of donning and lack of significant restrictions on normal movement during physical activity.
They have been shown to provide excellent ergonomics for BS 7971-1 Requirements.
The price is for a set for two legs.
There are varieties that are the same in purpose and use. We do not guarantee the exact match of the model to the photographs. There may be differences in the size of the shields, in the texture of the outer layer and the structure of the inner layer, etc.
We also do not guarantee that the models from Deenside will come, sometimes there are other manufacturers and the shields are very different in appearance.
One thing we guarantee – identical shields will come in one set, so that it does not turn out that you have one option on your right leg, and another option on your left.
In Britain, these are the new $ 92.
- Separated by height.
- short – 160-170
- regular – 170-180
- long – 180-190
- xlong – 190-200
How to choose hockey pads.Sizes of hockey knee pads
The knee joint is one of the largest and most complex-structured joints in the human musculoskeletal system. Even a minor injury can cause long-term discomfort and affect the player’s behavior on the court, and over the length of the rehabilitation period, it can break many records. Hockey pads or knee pads are an element of a player’s equipment that protects the knee joint, calves and shin of the player from falls, blows with a club or puck hits, from cuts by the blades of skates.Even just going out on the ice to “try”, you need to have reliable leg protection, preferably individually selected. How to choose the right hockey pads …
When choosing hockey shin guards, one should be guided by the role of the hockey player (defender or striker) and, therefore, what kind of load they will be subjected to. All ice hockey knee pads, both beginner and professional, are divided into three types: for defenders, for strikers and for goalkeepers.
Defender guards have a wider design and provide an increased level of protection.Often they are provided with an additional pad that covers the calves. But the high level of protection also carries disadvantages: it is difficult to move quickly in such knee pads.
Striker pads are easily recognizable by their streamlined design. They are narrow, graceful and lightweight. In such knee pads it is convenient to move swiftly, attacking the enemy.
Goalkeeper pads are longer than usual. There are no special rules in the selection of the goalkeeper’s leg protection: the main factor is the athlete’s subjective feelings.Particular attention should be paid to how the patella is positioned. If the knee pads are “yours”, then the kneecap should rest, resting on a soft cushion.
Structurally, hockey shields consist of two main parts: a knee cap made of impact-resistant plastic; form-fitting shin protector made of various foams. Depending on the model, the cushioning lining can be multi-layered, with a lateral wraparound shin protector and an adjustable / removable ankle protector.Regardless of the manufacturer, the hockey shin guards are secured with anchoring straps made of elastic material. Most of the knee pads are equipped with special “Velcro”, which allows you to comfortably fix the protection on the leg.
When choosing hockey shields, it is necessary to take into account the features of the rest of the hockey player’s protective ammunition.
For example, it is necessary to take into account that during operation they constantly come into contact with hockey pants in the area of the kneecap. The pad of the knee pad should be partially under the hip protector of the shorts, but at the same time, this “connection” should not interfere with flexion / extension of the knee joint.Those. shorts and shorts must not cling to each other during play. To do this, it is advisable to put on both of these items of equipment during the fitting and sit down several times. Subjective feelings when trying on will be the main criteria for choosing.
Another important place to look for when choosing hockey shin guards is where they come into contact with the skates. The ways of combining these items of equipment are individual. This is how some hockey players tuck the tongue of the skate under the visor, while others prefer to leave the tongue outside.In any case, comfort and convenience remain the main criterion when choosing.
To select the correct hockey pads, measure your shin length from mid-patella to top of the skate and find the corresponding size in the size matching chart below. Calf length is best measured while sitting. Check the hit in the other parameters shown in the table, such as height, weight and age of the player.
Hockey Pads Size Correspondence Chart
ATTENTION: The dimensions given in the table should only be taken as guidelines.Dimensions may vary depending on the manufacturer.
