Hockey Shoulder Pads: Essential Protection for Players on the Ice

What are the key benefits of hockey shoulder pads. How do professional-grade shoulder pads differ from standard options. Why is proper shoulder protection crucial for hockey players at all levels. What factors should players consider when selecting shoulder pads.

The Importance of Hockey Shoulder Pads in Player Safety

Hockey shoulder pads are a critical piece of protective equipment for players at all levels of the sport. These pads offer vital protection to several vulnerable areas of the upper body, including the collarbone, chest, ribs, back, and biceps. But why exactly are shoulder pads so crucial for hockey players?

The primary function of hockey shoulder pads is to absorb and distribute the impact of collisions, falls, and pucks. In a fast-paced, physical sport like hockey, players are constantly at risk of hard body checks, crashing into the boards, or taking a high-speed puck to the upper body. Without proper shoulder protection, these impacts could lead to serious injuries.

Are all hockey shoulder pads created equal? Not at all. Professional-grade shoulder pads, like those used in the NHL, offer superior protection and performance compared to standard retail options. These pro-stock pads are engineered to withstand the rigors of top-level play while still allowing for optimal mobility and comfort.

Pro-Stock Hockey Shoulder Pads: A Cut Above the Rest

Pro-stock hockey shoulder pads represent the pinnacle of protective gear in the sport. These are the same pads worn by NHL players, designed to meet the demands of the world’s most elite hockey league. But what sets pro-stock shoulder pads apart from regular retail options?

• Superior materials and construction
• Custom-made for professional players
• Optimized balance of protection and mobility
• Lightweight design for enhanced performance
• Built to withstand the toughest game conditions

Pro-stock shoulder pads are manufactured to the highest specifications, often incorporating advanced materials and innovative design features not found in standard retail models. This results in gear that offers unparalleled protection without sacrificing comfort or range of motion.

Key Features of High-Quality Hockey Shoulder Pads

When evaluating hockey shoulder pads, there are several key features that players should consider. These elements contribute to the overall effectiveness and comfort of the pads:

1. Coverage area: Ensure the pads protect all vulnerable areas of the upper body
2. Fit and adjustability: Look for pads that can be customized to your body shape
3. Ventilation: Proper airflow helps manage heat and moisture during play
4. Weight: Lighter pads can improve mobility and reduce fatigue
5. Impact absorption: High-density foams and plastic inserts enhance protection
6. Flexibility: Segmented design allows for natural movement

How do these features translate to on-ice performance? By providing comprehensive protection without hindering movement, high-quality shoulder pads allow players to focus on their game without worrying about potential injuries. This confidence can lead to more aggressive play and better overall performance.

The Evolution of Hockey Shoulder Pad Technology

Hockey shoulder pads have come a long way since the early days of the sport. Early versions were often bulky and restrictive, offering limited protection and hampering player mobility. How have shoulder pads evolved over the years?

Modern shoulder pads benefit from advances in materials science and biomechanical research. Manufacturers now use lightweight, high-impact foams and plastics that offer superior protection while reducing overall weight. Computer-aided design and 3D modeling have allowed for more anatomically correct shapes, improving fit and comfort.

Some of the latest innovations in hockey shoulder pad technology include:

• Moisture-wicking liners to keep players dry
• Anti-microbial treatments to combat odor-causing bacteria
• Customizable protection levels for different playing styles
• Integration with other protective gear for seamless coverage
• Smart materials that stiffen upon impact for enhanced protection

These advancements have resulted in shoulder pads that not only offer better protection but also enhance player performance by allowing for greater freedom of movement and improved comfort during extended play.

Choosing the Right Hockey Shoulder Pads for Your Needs

Selecting the appropriate shoulder pads is crucial for maximizing protection and performance on the ice. But with so many options available, how can players ensure they’re making the right choice?

Consider the following factors when choosing hockey shoulder pads:

1. Playing level: Higher levels of play generally require more robust protection
2. Position: Defensemen may prefer more coverage, while forwards might opt for increased mobility
3. Body type: Ensure the pads fit your frame properly for optimal protection
4. Playing style: Aggressive players may need extra reinforcement in high-impact areas
5. League regulations: Some leagues have specific requirements for protective gear

It’s also important to try on multiple options and, if possible, test them out on the ice before making a final decision. Remember that the most expensive pads aren’t always the best choice for every player – finding the right balance of protection, comfort, and performance is key.

Maintaining and Caring for Your Hockey Shoulder Pads

Proper maintenance of hockey shoulder pads is essential for ensuring their longevity and continued effectiveness. How can players keep their shoulder pads in top condition?

Follow these tips to extend the life of your hockey shoulder pads:

• Air out pads after each use to prevent moisture buildup
• Clean pads regularly with mild soap and water
• Avoid machine washing or drying, as this can damage the protective components
• Inspect pads regularly for signs of wear or damage
• Replace pads when they no longer provide adequate protection

By properly caring for your shoulder pads, you can ensure they continue to provide optimal protection throughout their lifespan. This not only saves money in the long run but also helps maintain consistent performance and safety on the ice.

The Role of Shoulder Pads in Injury Prevention

While no piece of equipment can completely eliminate the risk of injury in hockey, shoulder pads play a crucial role in minimizing the severity and frequency of upper body injuries. But just how effective are shoulder pads in preventing hockey-related injuries?

Research has shown that properly fitted shoulder pads can significantly reduce the risk of injuries to the chest, shoulders, and upper back. They are particularly effective in protecting against:

• Collarbone fractures
• Shoulder separations
• Chest contusions
• Upper back injuries
• Rib fractures

However, it’s important to note that shoulder pads are just one component of a comprehensive approach to injury prevention in hockey. Proper technique, conditioning, and adherence to rules and regulations are equally important factors in keeping players safe on the ice.

Common Misconceptions About Hockey Shoulder Pads

Despite their importance, there are several misconceptions about hockey shoulder pads that persist among players and fans. Let’s address some of these myths:

1. Myth: Bigger pads always offer better protection
2. Reality: Proper fit and design are more important than size alone
3. Myth: Pro-stock pads are too expensive for amateur players
4. Reality: Many pro-stock options are competitively priced and offer excellent value
5. Myth: Shoulder pads limit mobility and hinder performance
6. Reality: Modern pads are designed to enhance mobility while providing protection
7. Myth: All shoulder pads offer the same level of protection
8. Reality: There are significant differences in quality and effectiveness between models

By understanding these realities, players can make more informed decisions when selecting and using hockey shoulder pads.

The Future of Hockey Shoulder Pad Design

As technology continues to advance, what does the future hold for hockey shoulder pad design? Manufacturers are constantly innovating to improve protection, comfort, and performance. Some emerging trends in shoulder pad technology include:

• Integration of sensor technology to monitor impacts and player fatigue
• Use of advanced materials like graphene for improved strength-to-weight ratio
• 3D-printed custom pads tailored to individual player physiques
• Enhanced breathability through innovative ventilation systems
• Improved integration with other protective gear for seamless coverage

These advancements promise to further enhance player safety and performance, potentially revolutionizing the way hockey is played at all levels.

The Impact of Rule Changes on Shoulder Pad Design

As hockey governing bodies continue to prioritize player safety, rule changes can have a significant impact on equipment design. How might future rule changes affect shoulder pad development?

Potential areas of focus for future regulations include:

1. Standardized testing protocols for impact resistance
2. Mandatory use of specific protective features in certain levels of play
3. Restrictions on materials or designs that may increase injury risk to opponents
4. Requirements for enhanced visibility or trackability of protective gear

Equipment manufacturers will need to stay ahead of these potential changes, developing innovative solutions that meet both regulatory requirements and player needs.

Hockey Shoulder Pads, Pro Stock, NHL Ice Hockey Shoulder Pads

Pro Stock Hockey Shoulder Pads

Pro Stock Hockey is your best resource for high-quality, pro stock ice hockey shoulder pads – the same shoulder pads the NHL pros use! We offer the best selection of pro stock hockey shoulder pads available anywhere, with various sizes in stock to meet every player’s needs. What’s more, our selection includes products from leading brands like Warrior, Reebok, CCM, Bauer and Easton. Click through our inventory above to learn more.

Our NHL shoulder pads are 100% authentic pro stock gear: the items you see in our online store were made for NHL players, but never used, or in rare cases, lightly used. These are the best hockey shoulder pads on the market, manufactured to the highest specifications for the best players in the world, playing in the toughest game conditions in the world. They’re custom made and built strong but are surprisingly lightweight, giving you the ideal combination of protection, comfort and unrestricted movement. Wearing our pro stock shoulder pads might not be the only reason you score the game-winning goal or make a game-saving block, but they can definitely help keep you in the game.

WHY WE HAVE THE BEST HOCKEY SHOULDER PADS

There are plenty of reasons why buying your equipment from Pro Stock Hockey is a great move. Buying pro stock shoulder pads from our online store means gaining benefits like these:

• Authentic Pro Stock Hockey Shoulder Pads:
  Our company works directly with NHL teams to obtain our pro stock gear, so you can be sure every shoulder pad item you see is the genuine article.
• High Quality:
  We already mentioned that our pro stock shoulder pads are manufactured to the highest standards, but we don’t just take their word for it. Every item that comes into our inventory is thoroughly inspected by our quality control team — who, by the way, are amateur hockey players themselves! We make sure every set of shoulder pads is game-ready before we offer it for sale.
• Total Protection:
  Shoulder pads are a critical piece of your hockey equipment, offering much needed protection to the collarbone, chest, ribs, back and biceps. Shoulder pads are definitely an item you don’t want to cut corners on and, because of our pro stock quality, you don’t have to! Our shoulder pads are manufactured to protect NHL players in NHL game conditions so you can feel confident as you step in to block that next shot.
• Excellent Prices:
  Buying from Pro Stock Hockey almost always means getting better prices than you’ll find at retailers, pro shops and other online stores. We buy all of our pro stock gear in volume, and pass the savings on to you. At Pro Stock Hockey, you’ll find shoulder pads of the highest quality, at prices that can’t be beat. Low prices and high quality gear – now that’s a winning combination.
• Exceptional Service:
  Buying from Pro Stock Hockey is a pleasant experience from beginning to end because we make it our goal to deliver excellent service from the moment you come to our site to the moment the gear arrives at your front door. Because we play hockey and love the game, we know how important your shoulder pads are. Our staff is ready and waiting to help answer any questions you might have about our pro stock equipment and help you make the right selection. When you order, we’ll make sure your shoulder pads are packaged securely and shipped as quickly as possible. We monitor every service detail every step of the way because if it matters to you, it matters to us.

STAY IN TOUCH FOR SPECIAL DEALS ON NHL PRO STOCK SHOULDER PADS

Looking to save even more money on ice hockey shoulder pads? We want to help! Connect with us on social media and subscribe to our newsletter, and you’ll be among the first to hear about special offers and new inventory arrivals. We use our newsletter, along with Google Plus, Twitter, Facebook and Instagram to keep our followers in the loop about Pro Stock Hockey bargains. We want you as a Pro Stock Hockey customer…but we also want you to have plenty of funds left over to celebrate after your next big win!

Also, keep in mind our inventory is constantly changing as we get new shipments of pro stock gear from NHL teams. We always suggest checking the inventory on our online store from time to time: if the exact item you’re looking for isn’t available today, there’s a chance it will be available tomorrow.

With shoulder pads from Pro Stock Hockey you’ll feel surprisingly comfortable and extremely well protected on the ice. The team at Pro Stock Hockey is committed to providing you with quality products, competitive prices and superior customer service from start to finish.

Shoulder Pads vs. Padded Shirts vs. Nothing- Discount Hockey

It’s time to finally answer the question that every hockey player has asked at one point or another: Do I really need to wear shoulder pads? The short answer is yes, but before the roller hockey players start saying how hot it is wearing all those extra layers outside or how you skate better on the ice without shoulder pads, please remember that safety is always a top priority when playing our great sport. The safer you are, the longer you can play, and in the end, the happier you will be! So let’s dive into this great debate and settle this topic once and for all.

There seem to be three options amongst the hockey community for types of upper body protection that should be used: Shoulder Pads, Padded Shirts, or nothing at all. Lets talk about the shoulder pads first. Shoulder Pads are hands down the only piece of upper body equipment that we recommend you wear during an ice hockey game. They will provide a sufficient amount of protection on your back and chest from sticks, pucks, and bumps from other players. The shoulder caps will protect you when battling down low along the boards. We have seen too many players who either don’t wear shoulder pads or wear padded shirts break collarbones, ribs, and sternums. Even if you are playing a pickup game or play in a lower level of hockey, the puck can still do some serious damage to you and the falls will hurt much more than if you had just worn a shoulder pad. That being said, we understand some players will be stubborn and not want to wear a shoulder pad because they find that it is too bulky for them. Here’s our advice: Find the lowest profile shoulder pads that fit you. The Winnwell Classic Shoulder Pads (Identical to the Sher-Wood 5030) are incredibly popular for these kinds of players as they are lightweight, have pretty minimal padding, and are some of the lowest profile shoulder pads out there. That being said, they aren’t going to offer you that much protection, but hey…It’s better than nothing!

Next up are padded shirts. These should really only be used by roller hockey players. They will offer sufficient protection from the high speed lightweight roller hockey pucks, but they won’t do much for you when falling down. Most of the time players fall on the knees or butts so it shouldn’t be too big of a deal for falls, but battling in the boards is always a sticky situation. Luckily, most if not all roller hockey leagues are non-contact and players tend to play with a little less aggressiveness. This means that when you are battling for the puck along the boards you are less likely to get rocked by some all-star who plays his 10PM Tuesday night game like it’s game 7 of the Stanley Cup Finals.  

Last but not least, let’s address simply not wearing shoulder pads. I mean, sure, don’t wear shoulder pads if you like getting bruises, if you have great health insurance, and pain brings you happiness. Shoulder pads are made and designed for a reason and that is to keep you healthy & protected. There are always people who can argue that they feel safe and fine without them or that they play better without wearing them, but that still doesn’t take away from the fact that you won’t be playing better when you inevitably get some bruised ribs, a cracked sternum, or a broken collar bone. I know so many guys who have gone down hard and regretted ever not wearing a shoulder pad. So as for a closing statement… There is never an excuse to not wear shoulder pads. They protect you from injury and that is really the most important thing. If you don’t like the bulky shoulder pads, give the Winnwell Classic Shoulder Pads a try and see what you think. They are lightweight, cheap, and very popular amongst roller and ice hockey players.

We hope this information helped you see the light. Thanks for reading and we’ll see you on the ice!

Bauer hockey sticks

Bauer hockey sticks

July 18, 2018 – Requip’d upcycles authentic, game-used hockey sticks into unique gifts like BBQ tools, BBQ sets, BBQ accessories, and one of a kind home goods for sports fans. Get your favorite hockey fan the gift they really want!

Bauer engineers the Supreme line of hockey sticks to deliver blistering power with maximum efficiency. Featuring a range of high-performance features, Bauer’s Supreme sticks earn a proud place in the company’s celebrated lineup.

Shop Bauer Hockey. S18 Bauer Vapor X700 Lite Griptac Hockey Stick, Senior, Intermediate, Junior From £35.00.

Best Hockey Sticks (2020) – Top Hockey Sticks For Beginners And Pros. If you are looking more for a high performance hockey stick, then the perfect hockey stick for you is the Bauer Vapor FlyLite.

Skates and sticks are the most sought after pieces of Bauer gear, but the company also offers a wide variety of best quality hockey helmets such as the Re-AKT, 9900 and IMS 11. 0.

BAUER Hockey. PPE & Masks All PPE & Masks Skates All Skates Shop Full Collection. … Street Hockey. Sticks; Protective; Goalie; Hockey Nets; Balls & Pucks; Knee Hockey;

Bauer Vapor Apx Stick, Bauer Ice & Roller Hockey Stick Blades, Bauer Vapor 11 In Adult’S Ice Hockey Skates, Bauer Ice & Roller Hockey Sticks, Vapor Trail Left Hand Arrow Rests, Bauer Ice & Roller Hockey Sticks & Accessories, Juniors Left-Handed Golf Clubs, Ice & Roller Hockey Stick Blades, Juniors Driver Left-Handed Golf Clubs,

Click here to buy the Bauer Supreme 1S stick today! Pictures from the upcoming Bauer Supreme 1S stick have begun to leak online and while details on the technology or updates remains vague…

Mfg crosswinds

Mask, Hand Made with Custom Color and Personalization, Ice Hockey Sticks Design GemLights. From shop GemLights. 5 out of 5 stars (5,492) 5,492 reviews $ 14.00 FREE … Bauer Supreme 1S Hockey Skate The Supreme line is back with the Bauer Supreme 1S hockey skates Say hello to the newly formulated Hoser Hockey Stick Wax 2. 0. The 2.0 maintains great…

Tcs batch 5 perm

Bauer Supreme 1S Hockey Stick Review by Source For Sports Hockey Jul 11, 2017 Updated for 2017, the new Bauer Supreme 1S stick is one of the most technologically advanced sticks ever made to give you the most powerful and accurate shot possible.

Whether shopping our selection of online hockey sticks and skates or visiting our New Jersey ProShop to buy hockey gear and accessories, rest assured you’re browsing only the highest quality of equipment. Our inventory is filled with the names you know and love, such as Bauer, CCM, and Sherwood.

We have composite hockey sticks in Youth, Junior, Intermediate and Senior sizes, in a wide selection of styles from brands like Bauer, CCM and Warrior. Shop online at Canadian Tire; pick up at any of 500+ stores. Score top corner with Bauer Hockey Sticks at Sportchek.ca. Shop the latest styles in Vapor, Supreme and Nexus!

Python encrypt password in config file

Contact Bauer Hockey on Messenger. Get #5xMore from your stick with the new #NEXUSGeo. With ER Spine technology from the NEXUS ADV, the Geo is designed to give you increased feel, elevated…

Aug 31, 2017 · Hockey Sticks HQ features reviews, roundups, and buying guides to help you find the best hockey sticks. … Hockey Stick Review: Bauer Vapor 1X. Bauer advertises …

Shop for bauer hockey sticks online at Target. Free shipping on orders of $35+ and save 5% every day with your Target RedCard. bauer hockey sticks. Looking for curbside pickup?Best Field Hockey Sticks – For Elite/Advanced Players. We have compiled a list of what we think are the 10 top field hockey sticks around. There are so many different field hockey brands and different sticks out there at the moment, so hopefully, these reviews will help you find the stick that is right for you.

Lg 65uf6450 parts

Mar 20, 2012 · The APX stick is 15 grams lighter and a stronger, more responsive stick – sounds awesome, right? The grip system is also a little different; Bauer is offering the traditional grip tac grip (tacky grip feel), but also a matted grip as well. Other elite-level sticks such as the Easton RS and Reebok Ai-Nine will feature this softer matted grip, too.

Bauer Nexus Geo Senior Hockey Stick Left / 70 / P28 – 349.99 Left / 70 / P88 – 349.99

A hockey stick is a piece of sport equipment used by the players in all the forms of hockey to move the ball or puck (as appropriate to the type of hockey) either to push, pull, hit, strike, flick, steer, launch or stop the ball/puck during play with the objective being to move the ball/puck around the playing…Sign Up For Our Mailing List To Get 10% Off! Find Your True Fit

Powershell move item overwrite file if exists

Junior Wood Hockey Sticks. Bauer 4500 Hockey Helmet.

Bauer Vapor X90 Composite Hockey Stick – Senior, Ice Hockey Stick. £95.68. Free P&P . Bauer Supreme 170 Composite Hockey Stick – Senior, Ice Hockey Stick. £72.68

BAUER Hockey. PPE & Masks All PPE & Masks Skates All Skates Shop Full Collection. … Street Hockey. Sticks; Protective; Goalie; Hockey Nets; Balls & Pucks; Knee Hockey; All Products > bauer hockey sticks. Bauer Nexus Geo Grip Composite Hockey Stick – Senior $299.99. Compare. Bauer Supreme 3S Grip Composite Hockey Stick – Senior $159.99.

How to remove permanent marker from brick

New Bauer Vapor Composite Ice Hockey Stick, 2018 Model Brand = Bauer Model = S18 Vapor 1X Lite Condition = New Handed = LH Curve = P88 Size Group = Jr. Flex = 40 Flex Grip = Grip ESIC#1 = instoreonly Item Number: 206-1826 Item ID: 27161 Category: Hockey Stick

Bauer is one of the most popular brands of hockey sticks, as well as other hockey gear. The company started in 1927 as a skate manufacturer. In 1994 Bauer was bought by Nike and rebranded…

Bauer Prodigy Composite Goal Stick Youth. The Prodgiy Goal Stick meets the demands of the S27 Goal Stick Junior Stick from Bauer is an entry level composite goalie stick that packs a lo…Hockey Plus offers the largest selection of Hockey Gear from the top brands in the industry like CCM, Bauer, Graf and Warrior at the best pricing available. If another outlet has a specific item in stock at a regular retail price lower than ours, our price match guarantee means we’ll match their pricing without hassle.

Decware se84ufo2

Bauer Nexus Geo Senior Hockey Stick Left / 70 / P28 – 349.99 Left / 70 / P88 – 349.99

Premier protein drinks amazon

Projector screen paint diy

Apply the 3 step approach to solve an ethical problem you are experiencing at work

1998 chevy tahoe two door for sale

The primary functions of protein in the human body include the following except

Desi serial sony entertainment

Nasa software engineer salary

Kellogg brown and root retirement benefits

Kaeser air compressor parts manual

Current pixel buds 2 firmware

Is gasoline a homogeneous mixture or a heterogeneous mixture

Tower defense simulator admin commands

Craftworld army list 2020

Furniture modern minecraft ps4

32 pesos to usd

Press any key to boot from usb keyboard not working

Ozark boat crash aftermath

Chrome release date

Custom optifine cape maker

Va environmental health coordinator

Best Youth Catchers Gear 2021: Reviews & Buying Guide

Catchers are an essential spot in any baseball game and are also very dangerous because of frequent fouls. So it would be best if you equipped your kids with the best youth catchers gear. It will help minimize the aftershocks when the ball hits the body. Scott Fujita will assist you in choosing a set that best suits your needs in this article!

• Detailed Reviews of The Best Youth Catchers Gear 2021
  • 1. Mizuno Samurai Catcher’s Gear Box Set
  • Mizuno Samurai Youth Baseball Boxed Catcher’s Gear Set, Grey-Navy, 14″ Youth Boys
  • 2. Rawlings Velo 2.0 NOCSAE Baseball Catcher’s Gear Set
  • Rawlings Velo 2.0 Youth NOCSAE Baseball Protective Catcher’s Gear Set, White and Silver
  • 3. EASTON BLACK MAGIC 2.0 Catcher’s Gear Set
  • EASTON BLACK MAGIC 2.0 Youth Catchers Protective Box Set, Youth, Age 9 – 12, Black, Small Helmet, Youth 14 in Chest Protector, Youth 12.5 in Leg Guards
  • 4. Rawlings Renegade Series Gear Sets
  • Rawlings Renegade 2.0 Youth NOCSAE Baseball Protective Catcher’s Gear Set, Navy and Silver, RCSNY-N/SIL
  • 5. Louisville Slugger Youth PG 5 Catchers Set
  • Louisville Slugger Youth PG Series 5 Catchers Set, Black/Gray
  • 6. TAG Battle Gear Series Gear Sets
  • TAG Youth Catchers Set, Battle Gear Series – Helmet, Body Protector, Leg Guards (Ages 9-12)
  • 7. CHAMPRO Optimus Pro Box Set Kit
  • CHAMPRO Optimus Pro Baseball and Softball Catcher’s Gear Box Set Kit, Scarlet, Youth, CBSP
  • 8. EASTON GAMETIME Equipment Box Set
  • EASTON GAMETIME Baseball Catchers Equipment Box Set, Intermediate, Black
• Buying Guides
• Frequently Asked Questions
• Final Thoughts

Detailed Reviews of The Best Youth Catchers Gear 2021

1. Mizuno Samurai Catcher’s Gear Box Set

Product highlights

The Mizuno Samurai Youth Catcher’s Gear Set includes the basics. Mizuno neatly packaged it in a storage bag. The Mizuno G4 helmet is suitable for youth players with head circumference sizes from 6½ to 7¼. The G3 leg guards measure 14 ½ inches from top to bottom.

The G3 chest protector measures 14 inches across and includes a removable hip protector. All components are black and gray. 

While it doesn’t have a throat protector, the Mizuno Samurai Youth Catcher’s Gear Set comes in many color options. You also get excellent protection and a great fit with it. 

The helmet has 3-layer EVA foam to protect the player’s head. They placed the air conditioning holes carefully for a constant flow of air. The aim is to keep the player’s head fresh. Finally, a steel mask in the front protects the player’s face without decreasing their visibility.

Mizuno Samurai Youth Baseball Boxed Catcher’s Gear Set, Grey-Navy, 14″ Youth Boys

$320.00

 in stock

2 new from $320. 00
2 used from $223.74

Free shipping

as of August 19, 2021 4:57 pm

OR

Best baseball turf shoes

Pros

• Excellent padding.
• Low rebound foam of chest protector.
• Ten different colors to choose.
• Suitable for catchers with glasses.
• Sleek design.

Cons

• The price is pretty high.

Bottom line

Most coaches and parents appreciate its performance, and many mentions using it over the seasons. If your team is looking for a set of youth catchers gear in 2021, this set is well worth considering.

2. Rawlings Velo 2.0 NOCSAE Baseball Catcher’s Gear Set

Product highlights

Rawlings is another instantly recognizable brand in the baseball world. Velo 2.0 Youth catcher’s set is for players under 12 years old. The size of its components suggest that it’s the best youth catchers gear set between the ages of 9-12.

Helmet sizes range from 6 1/2 to 7. It features a hockey-style mask that doesn’t sacrifice protection or visibility. For a snug fit, the helmet features an adjustable chin pad and 3-way adjustable backplate. 

The NOCSAE approved chest protector measures 13.5 inches. It also features one of the most remarkable acoustic technologies in a catcher: Arc Reactor Core. It is secondary to the ribcage, essential protection for the heart. 

It also absorbs the energy of the ball to help keep the bounces close. No one will dare to try and advance!

Rawlings Velo 2.0 Youth NOCSAE Baseball Protective Catcher’s Gear Set, White and Silver

$415.60
$297.67

 in stock

as of August 19, 2021 4:57 pm Any price and availability information displayed on Amazon at the time of purchase will apply to the purchase of this product.”/>

Pros

• Advanced technology.
• Snug fit.
• Absorb impact effectively.
• Maximize visibility.
• Exceptional temperature control.

Cons

Bottom line

Because of its sizing, the Rawlings Velo 2.0 is a perfect fit for older, more medium league players. The Arc Reactor Core will fit in the intermediate game. The size of this youth catchers gear means it’s a good catch for a 13 year old, maybe even older!

3. EASTON BLACK MAGIC 2.0 Catcher’s Gear Set

Product highlights

Easton’s second generation Black Magic gear set is perfect for youth catchers. It features a lightweight ABS shell helmet with a steel cage for increased visibility. A dual-density foam lining improves impact absorption and provides a secure fit.

High-density foam padded chest protector provides a shield from the impact of a fast-beating ball. It also has a Velcro closure attachment system for easy removal. The dual-back adjustment mechanism provides a custom fit to make it ideal for young players.

A foot protector with a two-knee design can protect the foot from substantial impact. It also features a Lock-down closure system that makes it easy to put on and take off.

EASTON BLACK MAGIC 2.0 Youth Catchers Protective Box Set, Youth, Age 9 – 12, Black, Small Helmet, Youth 14 in Chest Protector, Youth 12.5 in Leg Guards

 out of stock

as of August 19, 2021 4:57 pm Product prices and availability are accurate as of the date/time indicated and are subject to change. Any price and availability information displayed on Amazon at the time of purchase will apply to the purchase of this product.”/>

Pros

• Hockey style ABS plastic helmet.
• NOCSAE approved chest protector.
• Velcro Closure provides protection and comfort.
• PE shin pads.
• Affordable gear sets.

Cons

• Only one color is available.

Bottom line

The Easton’s Black Magic 2.0 best catcher’s gear set in 2021 is a great way to protect your kids’ body. With a stable price, this will be a suitable choice for parents to spend with their children.

4. Rawlings Renegade Series Gear Sets

Product highlights

If you want a youth catcher set but you have a tight budget, then the Rawlings Renegade Catcher’s Gear Set is perfect.

Rebel’s helmet fits hats that are 6.5 to 7 inches in size. The chest protector, on the other hand, measures 14 inches. The foot protector measures 13 inches. Overall, this is a good series for 9-12 years of age.

The new version features the same Coolflo and Pro Dri Plus ventilation systems. It also provides the same cooling and antiperspirant benefits for young catchers. 

They created the leg guards to keep the catchers light and agile. To protect the knees, they reinforced the shield around the knee area of the device with a flexible material.

Rawlings Renegade 2.0 Youth NOCSAE Baseball Protective Catcher’s Gear Set, Navy and Silver, RCSNY-N/SIL

$296.99

 in stock

as of August 19, 2021 4:57 pm

Pros

• Reasonable price.
• Lightweight and compact design.
• Good ventilation.
• ABS shell helmet.
• Dynamic fit system.

Cons

• The integrity of straps wear off quickly.

Bottom line

Rawlings catchers gear sets have always impressed us with their quality. Renegade is even better when you can own it for a very affordable price.

5. Louisville Slugger Youth PG 5 Catchers Set

Product highlights

The Youth PG Series 5 from Louisville takes a different approach to the last catcher kit we reviewed. This kit does not have Velcro but has an elastic band on the foot guard and a clip on the chest protector. 

This setup is more in line with more expensive gear sets. But the downfall of this is that newer catchers can take a while to put their gear back on. It will be trickier if they are not used to it.

What this gear set features is an anatomy-inspired shin guard with a dual-knee design. The goal is for a snug fit and less restricted range of motion. 

Louisville Slugger Youth PG Series 5 Catchers Set, Black/Gray

$247.99

 in stock

as of August 19, 2021 4:57 pm

Pros

• Removable shoulder caps.
• Good rebound control.
• It meets NOCSAE standards.
• Moisture wicking chin pad.
• Dual-knee shin guards.

Cons

• The helmet is a little narrow.

Bottom line

If youth players are not comfortable playing catcher, they will not want to play this position in the future. So this best catcher’s gear set in 2021 will help a lot for beginner and intermediate players.

6. TAG Battle Gear Series Gear Sets

Product highlights

Another bright choice on this best catcher’s gear 2021 list is this set from TAG. The set has all things you need for your minor catcher.

For ultimate protection, the helmet has a double-thick foam lining. In addition, the steel cage ensures safety for the player’s eyes and nose. Hockey style design is very convenient and fashionable to attract the eyes of the little ones.

The chest protector offers a 4-way protection. You can rest assured that it will wrap around your body securely. It is a big plus of this product.

In addition, the leg guards have an extremely sturdy design. It will wrap around the legs with a very eye-catching glossy finish.

TAG Youth Catchers Set, Battle Gear Series – Helmet, Body Protector, Leg Guards (Ages 9-12)

 out of stock

as of August 19, 2021 4:57 pm

Pros

• ABS plastic helmet.
• High quality catchers equipment.
• Internal PE plate.
• Wrap around padding leg guards.
• 4-way harness system.

Cons

• The chest sizing is relatively large for some kids.

Bottom line

For the age range of 9-12, this is a very reasonable choice for gear catchers. Not only does it have a fairly moderate price tag, it’s also full of portions. When investing in this gear, rest assured that your child will be able to compete behind the plate.

7. CHAMPRO Optimus Pro Box Set Kit

Product highlights

For baseball and softball we have the right choice for you – this catchers gear from Champro. This catcher’s set has everything a catcher needs with the latest technology.

Firstly, the manufacturer uses Bio-Fresh technology on the helmet to help prevent damage very well. It also makes this Optimus Pro helmet extremely sturdy. Dri-Gear technology absorbs moisture well, so it can keep catchers ventilated throughout the match.

Second, the chest protector comes with a shoulder cap for maximum protection. In addition, the manufacturer also includes a tail extension. You can keep it or remove it at any time – it’s very convenient.

Finally, the leg guards with cantilever liners minimize the force on the catchers’ shins. We should mention the advanced technologies that create durability and comfort for the wearer.

CHAMPRO Optimus Pro Baseball and Softball Catcher’s Gear Box Set Kit, Scarlet, Youth, CBSP

 out of stock

as of August 19, 2021 4:57 pm

Pros

• Latest technology.
• Sturdy helmet, chest protector and leg guards.
• Moisture-absorbing material.
• Tail extension included.
• Affordable.

Cons

• No information is available.

Bottom line

Along with four fantastic color options, this will be a great choice for any parent. This catcher’s set will protect your child to the maximum. Plus, it comes with the latest technologies that are sure to maximize your comfort.

8. EASTON GAMETIME Equipment Box Set

Product highlights

It is impossible not to mention Easton in this list of best catchers gear sets 2021. Easton once stormed the market with Easton Elite X. This year, they have continued to raise the barrier with Easton Gametime.

Whether you’re buying this gear for practice or high-level competition, it’s a good fit. The NOCSAE standard helmet ensures maximum security.

The leg guards with triple-knee design are very rare in youth gear sets. With this design, it will become even more solid. Multi-layer foam chest protector has a standard ventilation system. Keep your body comfortable during wear.

EASTON GAMETIME Baseball Catchers Equipment Box Set, Intermediate, Black

$209.95

 in stock

8 new from $209.95
2 used from $187.08

Free shipping

as of August 19, 2021 4:57 pm

Pros

• Maximum safety.
• Strategic ventilation holes.
• Comfort foam on the inside of the case.
• Ergonomic chin cup.
• The top strap is adjustable and wide at the back.

Cons

Bottom line

Suitable for all age ranges, the Easton Gametime is a precious choice. Try it and we believe you will love it.

Buying Guides

Youth catcher gear is for the 9-12 age range

1. Components of a Youth Catcher’s Gear

Before you enter the tournament, you need to prepare yourself thoroughly. Whether your match is big or small, you still need to stay safe behind the plate. A catcher needs to be fully equipped with the following items:

• Catcher’s Mask or Catcher’s Helmet
• Chest protection
• Leg Guards or Shin Guards
• Knee Pads
• Cup or Jockstrap
• Protect your throat
• Catcher’s Mitt

However, it would cost a fortune to equip all of these. With youth players, things can be simpler. You only need the three most important items to protect yourself. It will save you a lot of money. They are a helmet, chest protector and leg guard.

Also, you should consider investing in a bag so you can carry your catcher’s gear set around. It will keep all your items organized and prevent them from getting lost. Such concentration in one place also makes transportation easier.

We’ll be focusing on a more in-depth review of these products to help you learn more about them!

2. Catcher’s Helmet

The head part is the most critical. To protect yourself from foul shots or misdirected balls, you must have a quality helmet. To be considered a quality catcher’s helmet, they need to be sturdy and easy to remove.

There are two different types of helmets on the market today. Each type has different features. We need to learn to get an objective view of them.

Types

Two types of catcher’s masks that are very popular are the traditional two-piece style and hockey style.

This classic facemask has been around since the 1800s. They will put padding around the forehead and jawline. 

The player wears it with a helmet facing backward, to fully protect the face and skull. Many seasoned professional catchers prefer this style. 

With it, they can quickly pull off the mask to track the baseball. The downside is it provides only moderate coverage and protection for the head and face.

This type of facemask is very popular among youth catcher players. Some professional catchers also love them.

This helmet is extremely safe because it covers the entire front, inside and back of the skull. Its shell is very thick, sturdy with thick padding. 

This hockey style mask can also protect your throat and jaw. However, their disadvantage is their bulkiness. This mask limits your view, and you can’t take them off quickly.

Sizing

Most manufacturers usually divide the size of the catcher’s helmet into two categories: youth and adult. The reason for this is that the face mask is easy to adjust and is very easy to fit on your head. You only need to pull the straps a few times to resize them.

Usually the target audience of youth masks is children 12 years old or younger. As for players 13 and older or high school catchers, they will use the adult size. However, the most important thing is still the right head size. So feel free to choose.

If you need a more precise formula, measure your head circumference (above your ears). Usually a 22-inch head circumference will equate to a size 7 catcher’s helmet. You can compare that on the manufacturer’s size chart from there.

You should choose carefully for a high quality catcher set

3. Catcher’s Chest Protector

You will need chest protectors to protect your torso area. This largest protection will cover your shoulders, chest and neck to avoid collisions with bad balls. 

Without this padded armor, injury is completely possible. And we believe you don’t want to see your child break ribs or have huge bruises all over his body.

Material

The shape of the chest protector is universal. You can see the chest protector with foam padding covering the upper body and fixed straps at the back. 

However, it contains much more than that. And you may wonder why there are chest protectors at a much higher price than other products?

What determines its price is the material of the foam padding. Depending on their shape, quality and technology, we can determine the price of a chest protector.

With more expensive options, the form part will have a design that fits and hugs the body. In addition, the foam layer will be much lighter and more durable.

It has better impact absorption ability to minimize the impact force on the body. You can move more easily when using this chest protector with this foam layer.

In contrast, cheap chest protectors often have a stiffer and heavier foam layer. It will limit body movement and make your kid feel heavier.

However, you still need to have irreplaceable standards no matter your budget. Choose a chest protector with detachable wings and chest. It will increase flexibility and increase protection around the crotch, hips and shoulders.

Breathability and coolness are also essential. Choose a chest protector with a breathable and moisture-wicking lining to keep your youth player cool while wearing it!

Sizing

As long as you can measure the exact size, buying a chest protector that fits will be very easy. To determine the right size, measure from the base of your neck to the top of your belt. You can then check with the manufacturer’s chest protector size chart.

4. Catcher’s Leg Guards

Leg guards protect shins, ankles and knees. It is essential for catchers who have to kneel throughout the match. Plus, it will protect your kids from scratches if they fall on the plate.

Types

It will extend from the shoe to just above the knee. Like the above two parts, they use soft padding to create comfort for the user. And of course the quality of the padding will determine the value of these leg guards.

Usually leg guards will have two types: double or triple knee caps. The triple knee type will better protect your feet. However, the double knee design provides flexibility in movement. For young players, easy movement will be the preferred choice.

Sizing

Just like measuring the size for chest protectors, finding the right size for leg guards is extremely easy. You only need to measure from the middle of the knee to the ankle. Then compare it with the size table.

Frequently Asked Questions

You should maintain the youth catching equipment set carefully

1. How to clean and maintain my catcher’s gear?

To clean a catcher’s set, use a mild detergent. You can wash it by hand or washing machine. However, if you choose to machine wash, select a delicate cycle. Then let the gear dry naturally in the air. Please do not put them in the dryer because it will damage its texture and material!

2. How often should you replace your gear catcher?

The shin guards are usually replaced annually or may take a little longer due to wear of the lining. Your helmet is only good for two years max. After that you should buy a new one or at least send it to NOCSAE and get it recertified.

Final Thoughts

Choosing the best youth catcher set is not an easy task, especially when there are so many choices on the market. However, think carefully before making a decision. We recommend that you invest in quality products for maximum peace of mind about your child’s safety!

Canadian, Western Hockey Leagues Adopt Vaccine Mandates for Teams

Monday, August 16th, the Canadian Hockey League, which oversees the WHL and Tri City Americans, announced effective immediately all teams will adopt a mandatory vaccine policy.

This policy will apply to (according to the CHL):

“In addition to players, the mandatory vaccination policy will apply to General Managers, Coaches, Head Scouts or Director of Player Personnel, Trainers, Equipment Managers, On-ice and Off-ice Consultants, On-ice Officials and ice level Off-ice Officials (penalty box attendants; timekeepers and scorekeepers) and any other individuals who interact directly and on a regular basis with players.”

This will not affect public address announcers, music/presentation workers, and others in the PA booth; or any other gameday workers who do NOT have regular contact with the team.

Of course, this will NOT apply to fans.

WHL Commissioner Ron Robison had this comment:

“With travel restrictions currently in place with the Canada / U.S. border as well as the province of Manitoba, it is important all players and staff are fully vaccinated in order to be eligible to play a full season in the WHL…”

He also strongly suggested that players be staying with billets (host families) who are fully vaccinated.

All the previously mentioned persons with the team must be fully vaccinated with a Canadian Health approved vaccine 14 days prior to the beginning of the 2021-22 CHL-WHL season, which starts Oct. 1st.

Even though the Americans and WHL will have a full regular-season schedule, there will be no intermingling of conferences. The Ams won’t go on their annual Eastern or Central Division road swing, nor will those teams be coming here.

So, we will not be seeing teams such as Calgary, Prince Albert, Lethbridge, Saskatoon, or other Central or Eastern Division/Conference foes.

Aside from ten games vs. Prince George, Kelowna, Victoria, Kamloops, and Vancouver (the British Columbia Division) the rest of the entire schedule is vs. U.S. Division teams only. This will certainly amp up the Highway 395 rivalry vs. Spokane!

CHECK IT OUT: 100 sports records and the stories behind them

Field hockey, volleyball all-stars Taunton, B-R, Dighton-Rehoboth

TAUNTON — Greater Taunton field hockey and girls volleyball teams managed to dodge the unknown of a COVID high school season.

Field hockey teams were forced to play a new format of seven-on-seven due to the pandemic. Taunton had its season canceled after four games.

Most girls volleyball teams were moved to the Fall II season in March.

Here are the Taunton Daily Gazette’s 2021 Field Hockey and Girls Volleyball All-Scholastic members.

Bridgewater-Raynham

Sara Spatola

Spatola, a senior captain, was very good for the Trojans during a shortened season in 2020 … named a Southeast Conference All-Star … scored the winning goal against Brockton during the newly, seven-on-seven format … great leadership skills at the midfield spot … will attend the University of South Florida in the fall.

Paige Tanes

Tanes, a senior captain, was one of the top players for the Trojans during a shortened season in 2020 … named a Southeast Conference All-Star …worked hard on offense at the midfield spot … consistently pushes the ball downfield … will attend Syracuse University in the fall. 

Dighton-Rehoboth

Jenna Kelley 

Kelley, a senior captain, was the center of the Falcons offense during the Fall II season in 2021 … finished with three goals and nine assists … named a South Coast Conference all-star …has explosive speed and great stick skills … took command of the field both offensively and defensively during the new seven-on-seven format … a complete, all-around player … a four-year varsity player.

Sarah Howard 

Howard, a senior captain, had a great season defensively for the Falcons in the 2021 Fall II season … led the team in defensive stops behind goalie Emelia Tremblay … a two-year varsity player … great tackling skills and plays a passive, aggressive defense … often stopped breakaways and came away with loose balls … named a South Coast Conference honorable mention.

Emelia Tremblay 

Tremblay, a senior captain, was strong in net all season long for the Falcons during the 2021 Fall II season … she had an 88% save percentage … remains cool and calm between the pipes … very agile and aggressive … named a South Coast Conference all-star.

Katie Moura 

Moura, a senior forward, was an aggressive player for the Falcons all season long during the Fall II season in 2021 … scored seven goals and had three assists … had a goal in seven of the 10 games … led the team in carrying the ball the length of the field during the new, seven-on-seven format … has great stick skills … named a South Coast Conference honorable mention.

Taunton

Alana Tavares

Tavares, a senior captain, was one of the top forwards in the Hockomock League during a shortened season in 2020 …was a five-year varsity player … named a Hockomock League all-star … scored the winning goal in overtime against Oliver Ames for Taunton’s first-ever playoff win as a freshman … playing lacrosse at Marist College.

Ashley Amaro

Amaro was an up-and-coming star in the Hockomock League during a shortened season in 2020 … named a Hockomock League all-star … scored a pair of goals, including the tying goal against Mansfield in a 3-3 tie … plays softball for the Division I state champion softball team.

Jocelyn Pagliuca

Pagliuca, a senior captain, was the Tigers’ top defender during a shortened season in 2020 … was a five-year varsity player … always win battles to the ball … great defender in front of goalie Emily Gannon … played in Taunton’s first-ever playoff win over Oliver Ames as a freshman … captain and first singles player in tennis … will be attending Roger Williams University School of Architecture.

Second team all-stars: Erin Boehner (Bridgewater-Raynham), Lexia Blake (Bridgewater-Raynham), Emma Lavigne (Bridgewater-Raynham), Kam Marando (Dighton-Rehoboth), Cassie Lunghi (Dighton-Rehoboth), Emily Gannon (Taunton) and Skylar Rheaume (Taunton).

GIRLS VOLLEYBALL

Bristol-Plymouth 

Brenna Pierce 

Pierce had another solid season for the Craftsmen during the 2021 Fall II season … led the team in digs (77) and aces (47) … served at an 85% clip (177-for-209) … also contributed 45 kill shots … solid on defense … a former Taunton Daily Gazette Player of the Year.

Samantha Drass 

Drass, a middle hitter, was tough at the net all year long for the Craftsmen during the 2021 Fall II season … led the team in kill shots (60) and blocks (18) … contributed seven aces … a first-time Taunton Daily Gazette All-Scholastic.

Dijonae Young 

Young had a breakout season as the Craftsmen setter in 2021 … led the team in total assists … also contributed 30 digs and 27 aces … served at an 84% percent clip (133-for-158) … a first-time Taunton Daily Gazette All-Scholastic.

Bridgewater-Raynham 

Katie Rennie

Rennie, a senior, had a big year as a middle hitter for the Trojans in 2020 … led the team in kill shots with 45 … also contributed 10 aces … named a Southeast Conference all-star … a first-time Taunton Daily Gazette All-Scholastic.

Saadie Reid

Reid, a senior, was another solid player at the net for the Trojans in 2020 … collected 30 kill shots … also chipped in with 20 assists … named a Southeast Conference all-star … a first-time Taunton Daily Gazette All-Scholastic.

Madison McLaren

McLaren, a senior, had a terrific season for the Trojans in 2020 … led the team in service points with 53 … also contributed 32 assists and 37 hits … named a Southeast Conference all-star … was strong as an outside hitter … was clutch with her outside hits and serves … a first-time Taunton Daily Gazette All-Scholastic.

Logan Tavares

Tavares, a senior, was a strong hitter at the net for the Trojans in 2020 … contributed 33 hits … had 30 aces and 15 assists … named a Southeast Conference All-Star … strong left-handed hitter … a first-time Taunton Daily Gazette All-Scholastic.

Dighton-Rehoboth

Michaela Healy 

Healy was sensational for the Falcons during the Fall II season … led the team in kill shots (52) and blocked shots (26) … very active near the net … usually hit for a high percentage … had a season-high eight kill shots against Seekonk … a first-time Taunton Daily Gazette All-Scholastic.

Taylor Creel 

Creel was pretty consistent for the Falcons during the Fall II season … led the team in assists … she also had 30 aces and 10 digs … a solid passer … usually finds the right teammate …collected a season-high 17 assists against Apponequet … a first-time Taunton Daily Gazette All-Scholastic.

Taunton

Jaelyn Fernandez

Fernandez, a junior, had a solid year for the Tigers in the 2021 Fall II season … led the team in assists … had 37 assists, six aces and five kill shots against Mansfield … named a Hockomock League all-star … plays basketball in the winter … a Taunton Daily Gazette All-Scholastic.

Second team all-stars: Emily Marquis (Bristol-Plymouth), Katie Willette (Bristol-Plymouth), Julia Newcomb (Bridgewater-Raynham), Emily Marcotte (Dighton-Rehoboth), Kianna Reuter (Dighton-Rehoboth) and Mikayla Cleary (Taunton), Makena Travers (Taunton), and Fabiana Pereira (Taunton).

Herald News and Taunton Daily Gazette sports editor Steven Sanchez can be reached at [email protected]. You can follow him on  Twitter at @Chezsports. Support local journalism by purchasing a digital or print subscription to the Taunton Daily Gazette today.

Hockey Defense: Shoulders | Bauer, CCM, Warrio |

Shoulder pad, chest shield or “bib” in colloquial language – you can hear different names for this item every day. When starting to play hockey, hockey players often pay too little attention to shoulder pads.

It is believed that when playing hockey, the shoulder is subject to less mechanical stress, but in reality this is not the case. The shoulder pad is designed not only to protect the shoulder, but also to protect the back and chest.Players who regularly play ice hockey are regularly at risk of very painful punches to the sides, chest or even back. Since the shoulder pad is worn on more mobile parts of the body – the back and arms – special attention should be paid to how you feel in it, how comfortable you are.

The shoulder pad should not be too large or too small. If it is too large, it can snag on hockey pants and severely restrict body movement – waist rotation, arm maneuverability, and shoulder dexterity.The size of the hockey fittings for children and adults is determined by the weight and height of the player.

A good hockey shoulder pad provides complete upper body protection: neck bones, ribs, chest, back, biceps.

In order for new protective equipment to fit and play hockey well on the ice, protective equipment must not only look good, but also be comfortable and provide good protection against injury.

We offer a huge selection of hockey shoulder pads for adults and children.For players of all ages and levels, shoulder pads from the largest hockey equipment manufacturers in the world, Bauer, Warrior, CCM, Easton, Reebok .

Choose your hockey products only from an authorized dealer. We guarantee the lowest prices and the latest models!

We also recommend checking out the rest of our hockey protective equipment, such as hockey gloves, helmets and leg guards, as well as hockey clothing and hockey equipment for hockey players of all age groups and skill levels.

DR Shoulder pad X3. Shoulder protection Catalog. Trial-Sport.

SportRunningBicyclesYogaIce SkatesInline SkatesCross-Country SkisMountain SkisScootersSurfingSkateboardsSnowboardsTourism

CategoryEquipmentClothesShoesopticsProtectionAccessoriespartsTools

Adapter for refilling kartridzhaadapteryadaptery for fastening chehlaadaptery for pumping kolesaamortizatory rear for velosipedaaptechkibagazhniki avtobagazhniki for velosipedabazybalaklavyballony gas turisticheskieballony for pumping kolesabandanybandany mnogofunktsionalnyebatarei akkumulyatornyebliny vrataryabloki for yogibolty komplektbotinki vnutrenniebotinki for cross lyzhbotinki mountain lyzhbotinki for snoubordabotinki zimniebotinki with koshkamibotinki trekkingovyebryukibryuki korotkiebryuki legkiebryuki sportivnyebryuki termobelebryuki uteplennyevarezhkivarezhki with podogrevomvodra skladnyevelosipedy BMXvelosipedy begovelyvelosipedy mountain bikes electric mountain bikes cruiser bicycles pleasure bikes and tsepivynosy rulyagamakigamashigermetiki for kolosgermoupakovkigetrygidratorygirorotorygorelki turisticheskiegrebonkidatchiki for velokompyuteradatchiki serdtsebieniyadatchiki pedalirovaniyaderzhateliderzhateli speed velokompyuterovderzhateli for velosipedovderzhateli for flyagiderzhateli for schetkiderzhateli pereklyuchatelyaderzhateli handle pereklyuchatelyaderzhateli tormozovdetali for krepleniydiski for balansadiski for krepleniydiski brake for velosipedadoski for sapserfingadoski training for skalolazaniyadoski trenirovochnyedoski training for skalolazaniyadugi set pohodnyeemkosti remontnyydushi for vodyzhiletyzhilety zaschitnyezhilety with podogrevomzhilety Rescue handlebar plugsRopes clampsScooter clipsBackmarks Mountaineering rivetsBike locksLuggage locksBike locksChain locksSkate bindingsHit hooks hanging hooksAnkle protectorsBottom protectorsChoose protection ektzaschita loktyazaschita on zapyastezaschita on palkizaschita perazaschita plechzaschita podborodkazaschita predplechyazaschita frame komplektzaschita spinyzaschita shatunazaschita sheizvezdy for velosipedazvonkizerkala on rulinstrumenty komplektkabeli for velokompyuterovkamery for velosipedakamni abrazivnyekamusy for lyzhkamusy for splitbordovkantorezykarabiny alpinistskiekaretki for velosipedakarmany extra for palatkikartridzhi kit zapravkikartridzhi mnogorazovyekartridzhi disposable komplektkassetykassety for velosipedakastryulikedykepkiklinya for fixing remeshkaklipsyklyuchiklyuchi komplektklyuchi kit velosipedaklyushki ice hockey mats for yoga mats repair kit mats inflatable rugs touring helmet visor helmet visors wheels bicycle wheels bicycle bicycle set longboard wheels set of rollerskis wheels inline skate wheels set of scooter wheels skateboard wheels set of pads brake shoes disc brakes Onka steering velosipedakolyshkikoltsa for palokkoltsa for pilatesakoltsa prostavochnyekomplekt remontnyykomplekty for yogikomplekty for pumping kolesakomplekty for pilatesakomplekty balls for therapy rukkomplekty remontnyekomplekty transmission for velosipedakomplekty ropes and shirts tormozakompyutery for velosipedakonki myagkiekonki rolikovyekonki figurnyekonki hokkeynyekorziny for velosipedakosmetika bicycle komplektkostyumykostyumy gonochnyekostyumy for plavaniyakostyumy sportivnyekoftykofty termobelekofty flisovyekoshelkikoshki ledovyekrepezhi for plavnikovkrepleniya cross country lyzhkrepleniya for alpine skiingSnowboard AttachmentsSplitboard AttachmentsBackpack Helmet AttachmentsAction Camera AttachmentsAction Cam Beds Inflatable SneakersMugsWings Cycling Fenders Cycling Fenders Set Cassette Covers Steering Column Covers Swimwear Beach Jackets Jackets Windproof Jackets Protective Jackets Covers Jackets Covers Folders for paloklegginsyledobury alpinistskieledoruby alpinistskielezvie for konkovlezviya for konkovlenty for klyusheklenty obodnyelesenkilinzy spectacle maskalinzy solar ochkovlipuchkilishilozhkilongbordylongbordy minilopaty lavinnyelyzhi begovyelyzhi running komplektlyzhi gornyelyzhi mountain komplektmagneziya for skalolazaniyamagnity for velokompyuteramazi lyzhnyemaykimaskimaski vetrozaschitnyemasla for amortizatorovmasla for vilokmasla Brake sistemmebel camping komplektmeshki for magneziimeshki kompressionnyemeshki spalnyemiskimolotki skalnyemontazhkimontazhki komplektmyachi for balansanakidki from rain padsSlip padsHelmet protectorsSleeve padsSleeve padsSwitchshirt tipsSwitch shirt tipsBrake shirt tipsSwitch cable tipsBrake cable tipsBrake cable endsSleeve chainsBike pumpsBike chain tensionersBike chain tensionersBike socks lektotvertkiottyazhki alpinistskieottyazhki for palatkiochistiteliochistiteli for velosipedaochistiteli for tsepiochki maskiochki solntsezaschitnyepalatki turisticheskiepalki for cross lyzhpalki mountain lyzhpalki for lyzherollerovpalki Nordic hodbypalki trekkingovyepegipedali for velosipedapereklyuchateli velocity velosipedaperchatkiperchatki velosipednyeperchatki for cross lyzhperchatki with podogrevomperchatki hokkeynyepetli strahovochnyeplavkiplavnikiplastyriplatformy for krepleniyplatyaplity gas turisticheskiepovyazki on lobpodnozhki for velosipedapodushki turisticheskiepodshipniki komplektpokryshki for velosipedapolirolipolotentsapolotentsa for kovrikaposuda for tourism kit tourism canteen kit impregnation kit water repellent impregnation deodorant impregnation kit cross-country ski profiles rear shock absorber springs buckles suspension frames bicycle frames for roller skates rubbing washers straps straps for gaiters straps for mats straps for ice tools straps for ice tools straps for ice tools straps for ice tools iremni for krepleniyarepshnuryroga on rulrolikirolly therapy stoprubashkirubashki pereklyuchatelyarubashki short rukavomrubashki tormozaruli for velosipedaruchki remote upravleniyaruchki for palokruchki pereklyuchatelyaruchki rulyaruchki tormozaryukzakiryukzaki for roller konkovryukzaki lavinnyesalfetki for ochkovsamokatysandaliisanki ledyankisvyazki for cross lyzhsedla for velosipedasetka for fastening bagazhasetki for lampsetki moskitnyesidenya for transportation deteysidenya naduvnyesidenya pennyesistemy strahovochnyesistemy shnurovkiskakalkiskeytbordyskrebkislantsysmazki for velosipedasmazki chain bicycles for hockey glasses for lamps ramusumki on rulsumki podsedelnyesumki hokkeynyetarelkitenty turisticheskietermobele komplekttermosytopytormoza disk for velosipedatormoza for konkovtormoza for krepleniytormoza obodnyetreschotkitrosiki girorotoratrosiki pereklyuchatelyatrosiki tormozatrubkitrusy termobeletrusy hokkeynyetufli velosipednyetufli belt skalnyeudliniteli for ochkovuplotniteli for vizoraupory for ice instrumentaupory Rubber krepleniyauspokoiteli tsepiustroystva cleaning tsepiustroystva zaryadnyeustroystva negotiation komplektustroystva strahovochnyeutyugiutyazheliteli for rukfiksatory for karabinovfiksatory for koletsfiksatory for palokflyagi pitevyefonarifonari for bicyclesLights for touring shirtsT-shirts with a collarT-shirts with long sleevesT-shirts for thermal underwearSeat straps for bikes s on botinkichehly on velotuflichehly on blade konkovshaybyshayby hokkeynyeshapkishapki for plavaniyasharfyshatunyshatuny komplektshezlongishipy for obuvishipy for shoe nasadokshipy for komplektshkurkishlemyshlemy velosipednyeshlemy pedals to ride on roller konkahshlemy hokkeynyeshnur for dugshnurkishnurki for konkovshnurki for ochkovshnurok for ochkovshortyshorty velosipednyeshorty zaschitnyeshtyri podsedelnyeschetkischetki komplektyschitkischupy lavinnyeekrany vetrozaschitnyeekshn-kameryelementy pitaniyaespanderyyubkiyakorya

30 seven360 Degrees3TActive LeisureAdidasAlexrimsAll TerraAlpinaAreaArisunAsicsATIAtomicAvidAxiomBakodaBataleonBauerBickertonBionBlackspireBladerunnerBlizzardBluesportBorealBraveBrikoBrooksBuddy ChatBuffBulaBulletBurtonCane CreekCannondaleCarreraCCMChanexChargeChilliChinookCicloCleaveClimb XClimbing TechnologyCloudveilCodebaCombatCorratecCouloirCraghoppersCrankBrothersCrowCSTCycledesignD2bDalbelloDCDia-CompeDiamondDiatechDRDrakeDT SwissDuffsDynastarE ThirteenEagleEasternEastonEclatEclipticEdeaEiderElementEmmegiEndeavorEnduraEskaEurotrailEVFExelFabricFerlandFirst StrideFischerFive TenFlashFOXFOX ShoxFreetimeFSAFunscooFuseGaiamGarmontGlobeGonsoGordiniGoSystemGroovstarGTHADHayesHeadHell is for HeroesHuckeIcebreakerIndependentIndianaInnesIo BioIzjevskie KovrikiJamisJoytechK2KarrimorKEDKefasKendaKermaKidneykarenKMCL1LafumaLangeLazerLekiLelumiaLevelLicornLineLobsterLoloLookLooplineLowaMaceMach 1MadridMammutMangoManitouMankindMarkerMarzocchiMavicMDCMedalistMerinopowerMetoliusMetropolisMicheli nMicroSHIFTMilletMKMongooseMons RoyaleMotorexMRPNecoNHSNikeNirveNitroNomisNorcoNordicaNorthcapeNorthwaveO-SynceObermeyerOktosONE IndustriesOne WayOntarioOptiwaxOrageOutleapPallasPillarPOCPolaroidPowderhornPranaPremiumPrinceton TecPro FeetPro WheelPromaxPumaPure FixQloomRadioRaidenRebel KidzReebokRegattaReverseRexRichmanRideRiedellRisportRitcheyRockRockShoxRodeRoecklRollerbladeRome SDSRossignolRottefellaRSTRustySalomonSaltSamoxSauconySaxifragaSchoeffelSchwalbeScreamerSDGSea to SummitShimanoSinnerSixSixOneSkullcandySlegarSlideSmithSnoliSombrioSpeed ​​StuffSportalmSPRISpringyardSpyderSR SuntourSramStarStencilStormSun ValleySunRaceSunringleSuper.NaturalSupraSwitchbackSwixTakeyaTechnineTektroTempestaTevaThawTiogaTokoTorspoTrailsideTravelSafeTrekkoTrial-SportTruvativTSGTurtle FurTwentyTyroliaUbikeUFOUSD ProVansVettaVokulVPWall ActiveWarriorWASPcamWellgoWestbeachWeThePeopleWoodmanWTBX-FusionXposureYokoZeropointZippZootZycle FixZZYZX

2021/202220212020/202120202019/202020192018/201920182017/201820172016/201720162015/201620152014/201520142013/201420132012/201320122011/201220112010/201120102009/201020092008/200920082007/200820072006/200720062005/200620052004/200520042003/200420032002/200320022001/200220012000/200120001999/20001999

Hockey Bib Selection Guide

A bib is an obligatory component of a hockey player’s protective uniform.The main function of this element, sometimes called a carapace or shoulder pad, is to protect the player’s torso from blows with a puck and a club, as well as to protect the body from the consequences of falls and collisions.

Structural elements of the bib

The base of the protective carapace is made of high-strength synthetic fabric. The vest has an anatomical shape, supplemented with soft foam inserts, thanks to which it fits snugly to the body throughout its entire area. To ensure that the bib has a good grip on the body and does not slide out during the game, its inner surface is embossed.The carapace itself is fixed on the sides and around the forearms with wide elastic Velcro straps.

The thorax and back are protected by impact-resistant protectors. Segmented panels have increased rigidity, effectively absorb shock energy and reliably protect vital areas of the body. The carapace construction is usually fitted with side grips for improved rib protection. Additionally, there may be removable panels that protect the abdomen and lower back.

In addition to the front and rear protectors, an important part of the bib is the shoulder protection. They are presented with special cups that protect the shoulder joint, and shock-resistant cuffs that protect the biceps.

Hockey equipment manufacturers pay special attention to these elements. In modern bibs, cup pads have a complex multi-segment design, they can be adjusted in height and adjusted to the anatomical features of the hockey player.All of this is done in order to provide adequate protection for the shoulder joint while maintaining maximum freedom of movement for the player.

The biceps protectors consist of two cuffs that are movably connected to each other. In modern models, they have a polycarbonate core and a foam shell, thanks to which they effectively absorb impact energy. Biceps guards are usually removable. Advanced athletes occasionally release this section to provide more shoulder mobility.

Sizing and Fit

Hockey bibs are divided into three size groups: children (Youth / YTH), junior (Junior / JR) and adults (Senior / SR). The table shows the generally accepted classification of sizes and their correspondence to the main anthropometric parameters of the athlete.

The bib is tried on together with other items of equipment – elbow pads and protective shorts.With a properly fitted bib, the back protector should reach the top of the shorts; there should be no gaps or unprotected gaps between them.

With the right fit, the biceps protection reaches strictly to the elbow pad and only slightly overlaps it. Accuracy of landing is especially important here. There should be no gaps between the cuff and the elbow pad, as well as a large overlap, which will hinder the movement of the hand.

Having become in a hockey stance, slightly bending the legs and carrying the body forward, the bib should sit as comfortably as possible: do not restrict hand movements, naturally bend and unbend, do not move out and fit evenly over the entire surface of the body.

Criteria for effective protection

The key protective elements of the carapace are the aforementioned protectors. They take on the main percentage of shock loads, effectively extinguish their energy and reliably protect vital areas of the body – chest, spine, abdomen, lower back.

In professional models, the protector panels are made of composite porous foam combined with high-strength polymer materials. Such a shield, having a minimum weight, distributes and absorbs impact energy well, is resistant to cracking when the puck hits.

The multi-segment design of the protective insert provides freedom of movement. The more individual tread elements, the easier it is to fold in any direction, without hindering the movements of the hockey player and guaranteeing maximum mobility during playing maneuvers.

In the areas of the bib that are not protected by protectors, inserts made of foam materials of different densities are used. In more vulnerable areas – in the area of ​​the ribs, collarbone, abdomen, shoulders – high density foams are used.Such a material is able to withstand numerous shocks, absorb their energy and recover its shape after deformations.

Ventilation and breathability

The hockey bib must provide air circulation and efficiently drain excess moisture. These are fundamentally important points that guarantee the comfort and effectiveness of the game. The rapid evaporation of sweat prevents the body temperature from rising. Maintaining an optimal temperature balance allows the athlete to conserve energy, leaving more strength to play.This is especially felt at the end of the match, when the hockey player needs to activate all available reserves.

In matters of ventilation and moisture management, modern manufacturers of sports equipment offer a variety of solutions. In many professional models, the shells are supplemented with a system of ventilation ducts that ensure air circulation and prevent overheating of the body. Additionally, foams with high air permeability and moisture-wicking linings are used.

In progressive models of bibs, special microparticles are introduced into the fabric of the so-called. “Hot stones”. They effectively attract and wick away sweat, prevent overheating and keep clothes dry under the most stress. In places where the body is most intensely heated, the number of such elements increases.

Along with moisture-wicking technologies, modern bibs use inner linings with special antibacterial impregnations. They prevent the growth of bacteria and fungi and eliminate unpleasant odors.

Instead of a conclusion

Checklist for choosing a bib:

1. Availability of flexible multi-segment back and chest protectors.
2. Possibility of installing additional protective inserts for the abdomen and lower back.
3. Inserts of high density foam in the ribs, clavicle, cervical area.
4. The presence of wide elastic velcro.
5. Internal embossing for better fit of the bib.
6.Anatomically shaped adjustable shoulder cups and customizable bicep protection.
7. Sophisticated ventilation system.
8. Inner lining with antimicrobial impregnation.

.